Recombinant Full Length Human Interferon-Induced Transmembrane Protein 1(Ifitm1) Protein, His-Tagged
Cat.No. : | RFL19446HF |
Product Overview : | Recombinant Full Length Human Interferon-induced transmembrane protein 1(IFITM1) Protein (P13164) (1-125aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-125) |
Form : | Lyophilized powder |
AA Sequence : | MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYS VKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQ EKRGY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | IFITM1 |
Synonyms | 9-27; CD 225 ; CD 225 antigen; CD225; CD225 antigen; Dispanin subfamily A member 2a; DSPA2a; IFI 17; IFI17; IFITM1; IFM1_HUMAN; Interferon induced protein 17; interferon induced transmembrane protein 1 (9-27); Interferon induced transmembrane protein 1; I |
UniProt ID | P13164 |
◆ Recombinant Proteins | ||
IFITM1-4220H | Recombinant Human IFITM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL27865MF | Recombinant Full Length Mouse Interferon-Induced Transmembrane Protein 1(Ifitm1) Protein, His-Tagged | +Inquiry |
IFITM1-4434M | Recombinant Mouse IFITM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IFITM1-4316H | Recombinant Human IFITM1 protein, GST-tagged | +Inquiry |
IFITM1-3211H | Recombinant Human IFITM1 Protein (Met1-Phe57), C-SUMO tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFITM1-5283HCL | Recombinant Human IFITM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFITM1 Products
Required fields are marked with *
My Review for All IFITM1 Products
Required fields are marked with *