Recombinant Human IFNA2 protein, GST-tagged

Cat.No. : IFNA2-4181H
Product Overview : Recombinant Human IFNA2 protein(P01563)(24-188aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 24-188aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 46.2 kDa
AA Sequence : CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name IFNA2 interferon, alpha 2 [ Homo sapiens ]
Official Symbol IFNA2
Synonyms IFNA2; interferon, alpha 2; interferon alpha-2; alpha 2a interferon; IFN alphaA; IFNA; interferon alpha 2b; interferon alpha A; leIF A; IFN-alpha-2; alpha-2a interferon; INFA2; IFNA2B; IFN-alphaA; MGC125764; MGC125765;
Gene ID 3440
mRNA Refseq NM_000605
Protein Refseq NP_000596
MIM 147562
UniProt ID P01563

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNA2 Products

Required fields are marked with *

My Review for All IFNA2 Products

Required fields are marked with *

0
cart-icon
0
compare icon