Recombinant Human IFNA6 protein, GST-tagged
| Cat.No. : | IFNA6-191H |
| Product Overview : | Recombinant Human IFNA6 protein(NP_066282)(97-144 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 97-144 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | SVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVR |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | IFNA6 interferon, alpha 6 [ Homo sapiens ] |
| Official Symbol | IFNA6 |
| Synonyms | IFNA6; interferon, alpha 6; interferon alpha-6; IFN alphaK; leIF K; IFN-alpha-6; interferon alpha-K; interferon alpha-54; IFN-alphaK; |
| Gene ID | 3443 |
| mRNA Refseq | NM_021002 |
| Protein Refseq | NP_066282 |
| MIM | 147566 |
| UniProt ID | P05013 |
| ◆ Recombinant Proteins | ||
| IFNA6-20HFL | Active Recombinant Human Full Length IFNA6 Protein | +Inquiry |
| IFNA6-194H | Recombinant Human IFNA6 Protein, His-tagged | +Inquiry |
| IFNA6-079H | Recombinant Human IFNA6 Protein | +Inquiry |
| IFNA6-191H | Recombinant Human IFNA6 protein, GST-tagged | +Inquiry |
| IFNA6-3071H | Recombinant Human IFNA6 protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFNA6-5279HCL | Recombinant Human IFNA6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNA6 Products
Required fields are marked with *
My Review for All IFNA6 Products
Required fields are marked with *
