Recombinant Human IFNA6 protein, GST-tagged

• Cat.No.: IFNA6-191H
• Product Overview: Recombinant Human IFNA6 protein(NP_066282)(97-144 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 97-144 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: SVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVR
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: IFNA6 interferon, alpha 6 [ Homo sapiens ]
• Official Symbol: IFNA6
• Synonyms: IFNA6; interferon, alpha 6; interferon alpha-6; IFN alphaK; leIF K; IFN-alpha-6; interferon alpha-K; interferon alpha-54; IFN-alphaK
• Gene ID: 3443
• mRNA Refseq: NM_021002
• Protein Refseq: NP_066282
• MIM: 147566
• UniProt ID: P05013