Recombinant Human IFNA7 Protein, His tagged

• Cat.No.: HLA-G-21H
• Product Overview: Recombinant human HLA-G, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 25-308 aa
• Description: HLA-G, also known as HLA class I histocompatibility antigen, alpha chain G, belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-G is expressed on fetal derived placental cells. HLA-G is a non-classical class-I HLA molecule associated with anti-inflammatory and immuno-modulatory properties which interacts with inhibitory receptors (ILT2/ILT4/KIR2DL4) present on various immune cells. It inhibits proliferation of B cells, T cells and natural killer cells; and also induces regulatory T cells.
• Form: Liquid in Phosphate-Buffered Saline (pH 7.4) containing 20% glycerol
• Molecular Mass: 35.3 kDa
• AASequence: < MGSSHHHHHHSSGLVPRGSHMGSHM> GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPI
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.25 mg/mL (determined by absorbance at 280nm)

Gene Information

• Gene Name: HLA-G major histocompatibility complex, class I, G [ Homo sapiens (human) ]
• Official Symbol: HLA-G
• Synonyms: HLA-G; major histocompatibility complex, class I, G; HLA G histocompatibility antigen, class I, G; HLA class I histocompatibility antigen, alpha chain G; b2 microglobulin; HLA G antigen; HLA class I molecule; MHC class I antigen G; HLA-G histocompatibility antigen, class I, G; MHC-G
• Gene ID: 3135
• mRNA Refseq: NM_002127
• Protein Refseq: NP_002118
• MIM: 142871
• UniProt ID: P17693