Recombinant Human IFNAR1 protein, His-tagged
| Cat.No. : | IFNAR1-3262H |
| Product Overview : | Recombinant Human IFNAR1 protein, fused to His tag, was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | NTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLNKSSVFSDAVCEKTKPGNTSKIWLIVGICIALFALPFVIYAAKVFLRCINYVFFPSLKPSSSIDEYFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | IFNAR1 interferon (alpha, beta and omega) receptor 1 [ Homo sapiens ] |
| Official Symbol | IFNAR1 |
| Synonyms | IFNAR1; interferon (alpha, beta and omega) receptor 1; IFNAR; interferon alpha/beta receptor 1; IFRC; CRF2-1; IFN-R-1; IFN-alpha/beta receptor 1; interferon-beta receptor 1; beta-type antiviral protein; alpha-type antiviral protein; type I interferon receptor 1; cytokine receptor class-II member 1; cytokine receptor family 2 member 1; interferon-alpha/beta receptor alpha chain; AVP; IFNBR; IFN-alpha-REC; |
| Gene ID | 3454 |
| mRNA Refseq | NM_000629 |
| Protein Refseq | NP_000620 |
| MIM | 107450 |
| UniProt ID | P17181 |
| ◆ Recombinant Proteins | ||
| IFNAR1-001H | Recombinant Human IFNAR1 Protein | +Inquiry |
| IFNAR1-181HB | Recombinant Human IFNAR1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| IFNAR1-29420TH | Recombinant Human IFNAR1 | +Inquiry |
| IFNAR1-2510H | Recombinant Human IFNAR1 Protein (Lys28-Asn227), N-His tagged | +Inquiry |
| IFNAR1-2205R | Recombinant Rhesus IFNAR1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFNAR1-1643HCL | Recombinant Human IFNAR1 cell lysate | +Inquiry |
| IFNAR1-816CCL | Recombinant Cynomolgus IFNAR1 cell lysate | +Inquiry |
| IFNAR1-2372MCL | Recombinant Mouse IFNAR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNAR1 Products
Required fields are marked with *
My Review for All IFNAR1 Products
Required fields are marked with *
