Recombinant Human IFNAR1 protein, His-tagged

Cat.No. : IFNAR1-3262H
Product Overview : Recombinant Human IFNAR1 protein, fused to His tag, was expressed in E. coli.
Availability July 24, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : NTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLNKSSVFSDAVCEKTKPGNTSKIWLIVGICIALFALPFVIYAAKVFLRCINYVFFPSLKPSSSIDEYFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name IFNAR1 interferon (alpha, beta and omega) receptor 1 [ Homo sapiens ]
Official Symbol IFNAR1
Synonyms IFNAR1; interferon (alpha, beta and omega) receptor 1; IFNAR; interferon alpha/beta receptor 1; IFRC; CRF2-1; IFN-R-1; IFN-alpha/beta receptor 1; interferon-beta receptor 1; beta-type antiviral protein; alpha-type antiviral protein; type I interferon receptor 1; cytokine receptor class-II member 1; cytokine receptor family 2 member 1; interferon-alpha/beta receptor alpha chain; AVP; IFNBR; IFN-alpha-REC;
Gene ID 3454
mRNA Refseq NM_000629
Protein Refseq NP_000620
MIM 107450
UniProt ID P17181

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNAR1 Products

Required fields are marked with *

My Review for All IFNAR1 Products

Required fields are marked with *

0
cart-icon