Recombinant Human IFNG therapeutic protein (Interferon gamma-1b)
| Cat.No. : | IFNG-P011H |
| Product Overview : | Human Interferon gamma-1b (140 residues), produced from E. coli. Production of Actimmune is achieved by fermentation of a genetically engineered Escherichia coli bacterium containing the DNA which encodes for the human protein. Purification of the product is achieved by conventional column chromatography. The sequence displayed is a cDNA sequence which codes for human interferon gamma, as described by Gray et. al. and not specifically interferon gamma 1b. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 146aa |
| Description : | This gene encodes a member of the type II interferon family. The protein encoded is a soluble cytokine with antiviral, immunoregulatory and anti-tumor properties and is a potent activator of macrophages. Mutations in this gene are associated with aplastic anemia. The expression product is the active ingredient of Actimmune. |
| Molecular Mass : | 17.1 Kda |
| AA Sequence : | CYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQK SVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGR RASQ |
| Endotoxin : | < 1.0 EU per μg of the protein |
| Purity : | >95% |
| Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
| Alias : | IFNG; IFN-gamma; IFG; IFI; Interferon gamma-1b |
| Gene Name | IFNG interferon, gamma [ Homo sapiens ] |
| Official Symbol | IFNG |
| Synonyms | IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI; |
| Gene ID | 3458 |
| mRNA Refseq | NM_000619 |
| Protein Refseq | NP_000610 |
| MIM | 147570 |
| UniProt ID | P01579 |
| Chromosome Location | 12q14 |
| Pathway | ATF-2 transcription factor network, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; |
| Function | cytokine activity; interferon-gamma receptor binding; |
| ◆ Recombinant Proteins | ||
| Ifng-532M | Active Recombinant Mouse Ifng protein, His-tagged | +Inquiry |
| IFNG-2404F | Recombinant Ferret IFNG protein(Met1-Lys166), His-tagged | +Inquiry |
| IFNG-1164R | Recombinant Rhesus IFNG protein(Met1-Gln165), His-tagged | +Inquiry |
| IFNG-804S | Recombinant Sheep IFNG protein, His-tagged | +Inquiry |
| IFNG-480H | Active Recombinant Human IFNG protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
| IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
| IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
| IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNG Products
Required fields are marked with *
My Review for All IFNG Products
Required fields are marked with *
