Recombinant Human IFNG therapeutic protein (Interferon gamma-1b)
Cat.No. : | IFNG-P011H |
Product Overview : | Human Interferon gamma-1b (140 residues), produced from E. coli. Production of Actimmune is achieved by fermentation of a genetically engineered Escherichia coli bacterium containing the DNA which encodes for the human protein. Purification of the product is achieved by conventional column chromatography. The sequence displayed is a cDNA sequence which codes for human interferon gamma, as described by Gray et. al. and not specifically interferon gamma 1b. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 146aa |
Description : | This gene encodes a member of the type II interferon family. The protein encoded is a soluble cytokine with antiviral, immunoregulatory and anti-tumor properties and is a potent activator of macrophages. Mutations in this gene are associated with aplastic anemia. The expression product is the active ingredient of Actimmune. |
Molecular Mass : | 17.1 Kda |
AA Sequence : | CYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQK SVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGR RASQ |
Endotoxin : | < 1.0 EU per μg of the protein |
Purity : | >95% |
Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Alias : | IFNG; IFN-gamma; IFG; IFI; Interferon gamma-1b |
Gene Name | IFNG interferon, gamma [ Homo sapiens ] |
Official Symbol | IFNG |
Synonyms | IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI; |
Gene ID | 3458 |
mRNA Refseq | NM_000619 |
Protein Refseq | NP_000610 |
MIM | 147570 |
UniProt ID | P01579 |
Chromosome Location | 12q14 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; |
Function | cytokine activity; interferon-gamma receptor binding; |
◆ Recombinant Proteins | ||
IFNG-72HFL | Recombinant Full Length Human IFNG Protein, C-Flag-tagged | +Inquiry |
Ifng-5686M | Recombinant Mouse Ifng Protein (His23-Cys155), C-His tagged | +Inquiry |
Ifng-7469R | Active Recombinant Rat Ifng protein, hFc-tagged | +Inquiry |
IFNG-893M | Active Recombinant Mouse IFNG Protein, His-tagged | +Inquiry |
IFNG-8860H | Active Recombinant Human IFNG, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNG Products
Required fields are marked with *
My Review for All IFNG Products
Required fields are marked with *
0
Inquiry Basket