Recombinant Human IFNG therapeutic protein (Interferon gamma-1b)

• Cat.No.: IFNG-P011H
• Product Overview: Human Interferon gamma-1b (140 residues), produced from E. coli. Production of Actimmune is achieved by fermentation of a genetically engineered Escherichia coli bacterium containing the DNA which encodes for the human protein. Purification of the product is achieved by conventional column chromatography. The sequence displayed is a cDNA sequence which codes for human interferon gamma, as described by Gray et. al. and not specifically interferon gamma 1b.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 146aa
• Description: This gene encodes a member of the type II interferon family. The protein encoded is a soluble cytokine with antiviral, immunoregulatory and anti-tumor properties and is a potent activator of macrophages. Mutations in this gene are associated with aplastic anemia. The expression product is the active ingredient of Actimmune.
• Molecular Mass: 17.1 Kda
• AA Sequence: CYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQK SVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGR RASQ
• Endotoxin: < 1.0 EU per μg of the protein
• Purity: >95%
• Storage: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
• Alias: IFNG; IFN-gamma; IFG; IFI; Interferon gamma-1b

Gene Information

• Gene Name: IFNG interferon, gamma [ Homo sapiens ]
• Official Symbol: IFNG
• Synonyms: IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI
• Gene ID: 3458
• mRNA Refseq: NM_000619
• Protein Refseq: NP_000610
• MIM: 147570
• UniProt ID: P01579
• Chromosome Location: 12q14
• Pathway: ATF-2 transcription factor network, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem
• Function: cytokine activity; interferon-gamma receptor binding