Recombinant Human IGF1 protein
Cat.No. : | IGF1-527H |
Product Overview : | Recombinant Human IGF1 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 83 |
Description : | IGF-1 belonged to the insulin gene family, is a mitogenic polypeptide growth factor that stimulate the proliferation and survival of various cell types including muscle, bone, and cartilage tissue in vitro. It is produced primarily by the liver as an endocrine hormone as well as in target tissues in a paracrine/autocrine fashion. The production of IGF-1 is stimulated by growth hormone (GH) and can be retarded by undernutrition, growth hormone insensitivity, lack of growth hormone receptors, or failures of the downstream signaling pathway post GH receptor including SHP2 and STAT5B. The LR3IGF-1 is a long-term analog of human IGF-1, specifically designed and manufactured for mammalian cell culture to support large-scale manufacturing of recombinant biopharmaceuticals. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.2. |
Bio-activity : | Assay 1: Fully biologically active when compared to standard. Measured in a serum-free cell proliferation assay using human MCF-7 cells. The ED50 for this effect is 0.3-1.5 ng/ml, corresponding to a specific activity of > 6.7 × 10⁵ IU/mg.Assay 2: Fully biologically active when compared to standard. The ED50 as determined by the stimulation of protein synthesis using rat L6 myoblasts is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 10⁵ IU/mg. |
Molecular Mass : | Approximately 9.1 kDa, a single non-glycosylated polypeptide chain containing 83 amino acids. |
AA Sequence : | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
Endotoxin : | Less than 0.01 EU/μg of rHuLR3 IGF-1 as determined by LAL method. |
Purity : | >98% by SDS-PAGE analysis.>90 % |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IGF1 |
Official Symbol | IGF1 |
Synonyms | IGF1; insulin-like growth factor 1 (somatomedin C); insulin-like growth factor 1; IGF1A; MGF; IGF-IA; IGF-IB; somatomedin-C; mechano growth factor; insulin-like growth factor I; insulin-like growth factor IA; insulin-like growth factor IB; IGFI; IGF-I; |
Gene ID | 3479 |
mRNA Refseq | NM_000618 |
Protein Refseq | NP_000609 |
MIM | 147440 |
UniProt ID | P05019 |
◆ Recombinant Proteins | ||
Igf1-43M | Active Recombinant Mouse Igf1 Protein (Gly49-Ala118), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IGF1-085I | Active Recombinant Human LR3IGF1 Protein (83 aa) | +Inquiry |
Igf1-01B | Recombinant Bovine Igf1 Protein | +Inquiry |
IGF1-0244M | Active Recombinant Mouse IGF1 protein, Fc-tagged | +Inquiry |
Igf1-02B | Recombinant Bovine Igf1 Protein, Gly50-Ala119 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF1-5268HCL | Recombinant Human IGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IGF1 Products
Required fields are marked with *
My Review for All IGF1 Products
Required fields are marked with *
0
Inquiry Basket