Recombinant Human IGF1R protein(761-930 aa), C-His-tagged
Cat.No. : | IGF1R-2589H |
Product Overview : | Recombinant Human IGF1R protein(P08069)(761-930 aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 761-930 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | DTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGY |
Gene Name | IGF1R insulin-like growth factor 1 receptor [ Homo sapiens ] |
Official Symbol | IGF1R |
Synonyms | IGF1R; insulin-like growth factor 1 receptor; CD221; IGFIR; IGFR; JTK13; MGC18216; IGF-I receptor; soluble IGF1R variant 1; soluble IGF1R variant 2; insulin-like growth factor I receptor; MGC142170; MGC142172; |
Gene ID | 3480 |
mRNA Refseq | NM_000875 |
Protein Refseq | NP_000866 |
MIM | 147370 |
UniProt ID | P08069 |
◆ Recombinant Proteins | ||
IGF1R-0996H | Recombinant Human IGF1R Protein (S982-K1286), Tag Free | +Inquiry |
IGF1R-3148HAF488 | Recombinant Human IGF1R Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
IGF1R-5434H | Recombinant Human IGF1R protein, His-tagged | +Inquiry |
IGF1R-2037R | Recombinant Rhesus Macaque IGF1R Protein, His (Fc)-Avi-tagged | +Inquiry |
IGF1R-180H | Active Recombinant Human IGF1R protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF1R-2928HCL | Recombinant Human IGF1R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGF1R Products
Required fields are marked with *
My Review for All IGF1R Products
Required fields are marked with *