Recombinant Human IGF1R protein(761-930 aa), C-His-tagged
| Cat.No. : | IGF1R-2589H |
| Product Overview : | Recombinant Human IGF1R protein(P08069)(761-930 aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 761-930 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | DTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGY |
| Gene Name | IGF1R insulin-like growth factor 1 receptor [ Homo sapiens ] |
| Official Symbol | IGF1R |
| Synonyms | IGF1R; insulin-like growth factor 1 receptor; CD221; IGFIR; IGFR; JTK13; MGC18216; IGF-I receptor; soluble IGF1R variant 1; soluble IGF1R variant 2; insulin-like growth factor I receptor; MGC142170; MGC142172; |
| Gene ID | 3480 |
| mRNA Refseq | NM_000875 |
| Protein Refseq | NP_000866 |
| MIM | 147370 |
| UniProt ID | P08069 |
| ◆ Recombinant Proteins | ||
| IGF1R-4257H | Recombinant Human IGF1R Protein (Met1-Asn932), C-His tagged | +Inquiry |
| IGF1R-180H | Active Recombinant Human IGF1R protein, His-tagged | +Inquiry |
| IGF1R-4258H | Recombinant Human IGF1R Protein (Met1-Val492), C-His tagged | +Inquiry |
| IGF1R-50C | Recombinant Canine IGF1R Protein, His-tagged | +Inquiry |
| IGF1R-3148HAF647 | Recombinant Human IGF1R Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IGF1R-2928HCL | Recombinant Human IGF1R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGF1R Products
Required fields are marked with *
My Review for All IGF1R Products
Required fields are marked with *



