Recombinant Human IGF2R, His-tagged
Cat.No. : | IGF2R-29238TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1510-1761 of Human Mannose 6 Phosphate Receptor with N terminal His tag; 252 amino acids, 29kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1510-1761 a.a. |
Description : | The protein encoded by this gene is a receptor for both, insulin-like growth factor 2 (IGF2) and mannose 6-phosphate (M6P). The IGF2 and M6P binding sites are located on different segments of the receptor. This receptor functions in the intracellular trafficking of lysosomal enzymes, the activation of transforming growth factor beta, and the degradation of IGF2. While the mouse Igf2r gene shows exclusive expression from the maternal allele, imprinting of the human IGF2R gene appears to be polymorphic, with only a minority of individuals showing expression from the maternal allele. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 81 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSEKGLVY MSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQV LQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLI SLDKQTCTLFFSWHTPLACEQATECSVRNGSSIVDLSP LIHRTGGYEAYDESEDDASDTNPDFYINICQPLNPMHG VPCPAGAAVCKVPIDGPPIDIGRVAGPPILNPIANEIYLN FESSTPCLADKHFNYTSL |
Sequence Similarities : | Belongs to the MRL1/IGF2R family.Contains 1 fibronectin type-II domain. |
Gene Name | IGF2R insulin-like growth factor 2 receptor [ Homo sapiens ] |
Official Symbol | IGF2R |
Synonyms | IGF2R; insulin-like growth factor 2 receptor; cation-independent mannose-6-phosphate receptor; cation independent mannose 6 phosphate receptor; CD222; CIMPR; M6P R; MPR1; MPRI; |
Gene ID | 3482 |
mRNA Refseq | NM_000876 |
Protein Refseq | NP_000867 |
MIM | 147280 |
Uniprot ID | P11717 |
Chromosome Location | 6q25-q27 |
Pathway | Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Membrane Trafficking, organism-specific biosystem; |
Function | glycoprotein binding; insulin-like growth factor binding; insulin-like growth factor-activated receptor activity; mannose binding; phosphoprotein binding; |
◆ Recombinant Proteins | ||
IGF2R-2324B | Recombinant Bovine IGF2R protein | +Inquiry |
IGF2R-4465M | Recombinant Mouse IGF2R Protein, His (Fc)-Avi-tagged | +Inquiry |
IGF2R-341H | Recombinant Human IGF2R protein, His-Avi-tagged | +Inquiry |
IGF2R-677H | Active Recombinant Human IGF2R, His-tagged | +Inquiry |
IGF2R-290H | Recombinant Human IGF2R protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGF2R Products
Required fields are marked with *
My Review for All IGF2R Products
Required fields are marked with *