Recombinant Human IGF2R protein(501-580 aa), C-His-tagged

Cat.No. : IGF2R-2639H
Product Overview : Recombinant Human IGF2R protein(P11717)(501-580 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 501-580 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : AVDGSQTETEKKHFFINICHRVLQEGKARGCPEDAAVCAVDKNGSKNLGKFISSPMKEKGNIQLSYSDGDDCGHGKKIKT
Gene Name IGF2R insulin-like growth factor 2 receptor [ Homo sapiens ]
Official Symbol IGF2R
Synonyms IGF2R; insulin-like growth factor 2 receptor; cation-independent mannose-6-phosphate receptor; cation independent mannose 6 phosphate receptor; CD222; CIMPR; M6P R; MPR1; MPRI; M6PR; CI-MPR; MPR 300; M6P/IGF2R; IGF-II receptor; M6P/IGF2 receptor; CI Man-6-P receptor; 300 kDa mannose 6-phosphate receptor; insulin-like growth factor II receptor; cation-independent mannose-6 phosphate receptor; M6P-R;
Gene ID 3482
mRNA Refseq NM_000876
Protein Refseq NP_000867
MIM 147280
UniProt ID P11717

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IGF2R Products

Required fields are marked with *

My Review for All IGF2R Products

Required fields are marked with *

0
cart-icon