Recombinant Human IGLC1 protein, His-tagged
| Cat.No. : | IGLC1-776H |
| Product Overview : | Recombinant Human IGLC1 protein(P0CG04)(1-106aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1-106aa |
| Tag : | C-His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 13.4 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS |
| Gene Name | CCND1 cyclin D1 [ Homo sapiens ] |
| Official Symbol | IGLC1 |
| Synonyms | CCND1; cyclin D1; BCL1; PRAD1; U21B31; D11S287E; B-cell CLL/lymphoma 1; G1/S-specific cyclin D1; cyclin D1 (PRAD1: parathyroid adenomatosis 1); parathyroid adenomatosis 1; BCL-1 oncogene; PRAD1 oncogene |
| Gene ID | 595 |
| mRNA Refseq | NM_053056 |
| Protein Refseq | NP_444284 |
| MIM | 168461 |
| UniProt ID | P24385 |
| ◆ Recombinant Proteins | ||
| CCND1-1140H | Recombinant Human CCND1 Protein (Lue65-Arg245), His tagged | +Inquiry |
| Ccnd1-2611R | Recombinant Rat Ccnd1 protein, His-tagged | +Inquiry |
| IGLC1-14119H | Recombinant Human IGLC1, His-tagged | +Inquiry |
| Ccnd1-2610M | Recombinant Mouse Ccnd1 protein, His-tagged | +Inquiry |
| CCND1-1492H | Recombinant Human CCND1 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCND1-092HKCL | Human CCND1 Knockdown Cell Lysate | +Inquiry |
| CCND1-7713HCL | Recombinant Human CCND1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCND1 Products
Required fields are marked with *
My Review for All CCND1 Products
Required fields are marked with *
