Recombinant Human IGLC1 protein, His-tagged

Cat.No. : IGLC1-776H
Product Overview : Recombinant Human IGLC1 protein(P0CG04)(1-106aa), fused with C-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 1-106aa
Tag : C-His
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 13.4 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Gene Name CCND1 cyclin D1 [ Homo sapiens ]
Official Symbol IGLC1
Synonyms CCND1; cyclin D1; BCL1; PRAD1; U21B31; D11S287E; B-cell CLL/lymphoma 1; G1/S-specific cyclin D1; cyclin D1 (PRAD1: parathyroid adenomatosis 1); parathyroid adenomatosis 1; BCL-1 oncogene; PRAD1 oncogene
Gene ID 595
mRNA Refseq NM_053056
Protein Refseq NP_444284
MIM 168461
UniProt ID P24385

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCND1 Products

Required fields are marked with *

My Review for All CCND1 Products

Required fields are marked with *

0
cart-icon
0
compare icon