Recombinant Human IHH protein

Cat.No. : IHH-656H
Product Overview : Recombinant Human IHH protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 176
Description : IHH, encoded by the IHH gene in humans, belongs to the mammalian hedgehog family. It is expressed in adult kidney and liver. The function of IHH is involved in chondrocyte differentiation, proliferation and maturation especially during endochondral ossification. It regulates its effects by feedback control of parathyroid hormone-related peptide (PTHrP). IHH is also involved in yolk sac vasculogenesis, playing an important role in differentiation of epiblast cells into endothelial and red blood cells. Human IHH shares 100 % amino acid sequence identity with murine.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 1 × PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by its ability to induce alkaline phosphatase production by C3H10T1/2(CCL-226) cells is 3.0-10 μg/ml.
Molecular Mass : Approximately 19.8 kDa, a single non-glycosylated polypeptide chain containing 176 amino acids.
AA Sequence : IIGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG
Endotoxin : Less than 1 EU/µg of rHuIHH C28II as determined by LAL method.
Purity : >96% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name IHH
Official Symbol IHH
Synonyms IHH; Indian hedgehog; Indian hedgehog (Drosophila) homolog , Indian hedgehog homolog (Drosophila); indian hedgehog protein; BDA1; HHG2; HHG-2; Indian hedgehog homolog;
Gene ID 3549
mRNA Refseq NM_002181
Protein Refseq NP_002172
MIM 600726
UniProt ID Q14623

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IHH Products

Required fields are marked with *

My Review for All IHH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon