Recombinant Human IKBKB protein, His-tagged
| Cat.No. : | IKBKB-3571H |
| Product Overview : | Recombinant Human IKBKB protein(1-256 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | December 17, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-256 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQCVRMWPGTVAHSCNPSTLGGRGRWIS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | IKBKB inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta [ Homo sapiens ] |
| Official Symbol | IKBKB |
| Synonyms | IKBKB; inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta; inhibitor of nuclear factor kappa-B kinase subunit beta; IKK beta; IKK2; IKKB; NFKBIKB; IKK-B; I-kappa-B kinase 2; I-kappa-B-kinase beta; nuclear factor NF-kappa-B inhibitor kinase beta; IKK-beta; FLJ33771; FLJ36218; FLJ38368; FLJ40509; MGC131801; |
| Gene ID | 3551 |
| mRNA Refseq | NM_001190720 |
| Protein Refseq | NP_001177649 |
| MIM | 603258 |
| UniProt ID | O14920 |
| ◆ Recombinant Proteins | ||
| IKBKB-14132H | Recombinant Human IKBKB, GST-tagged | +Inquiry |
| IKBKB-255HF | Recombinant Full Length Human IKBKB Protein | +Inquiry |
| IKBKB-2661H | Recombinant Human IKBKB, GST-His | +Inquiry |
| IKBKB-6658Z | Recombinant Zebrafish IKBKB | +Inquiry |
| IKBKB-760H | Recombinant Human IKBKB, His-S | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IKBKB-849HCL | Recombinant Human IKBKB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IKBKB Products
Required fields are marked with *
My Review for All IKBKB Products
Required fields are marked with *
