Recombinant human IL10, Active

Cat.No. : IL10-1555H
Product Overview : Recombinant human IL-10 is a glycosylated, non-disulphide linked homodimer with an apparent molecular mass of 17 kDa due to glycosylation. Glycosylation contributes to stability in cell growth media and other applications.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Nicotiana Benthamiana
Tag : Non
Description : Interleukin 10 (IL-10) is an anti-inflammatory cytokine initially characterized as a T helper (TH)2 specific cytokine, however, further investigations revealed that IL- 10 production was also associated with T regulatory cell responses. It is now known that almost all cells of both the innate and adaptive arms of the immune system can express IL-10, including dendritic cells (DC), macrophages, mast cells, natural killer cells (NK), eosinophil"s, neutrophils, B cells, CD8C T cells, and TH1, TH2, and TH17 CD4C T cellsIL-10 functions by inhibiting pro-inflammatory cytokines made by macrophages and regulatory T cells including, IFN-γ, TNF-α, IL-2, and IL-3, IL-4, and GM-CSF. IL-10 is also known to suppress antigen presentation on antigen presenting cells. It also stimulates the growth of mast cells, is a cytotoxic T cell differentiation factor, and stimulates B cell differentiation.
Form : Recombinant human IL-10 is lyophilized from a Tris HCl 0.05M buffer at pH 7.4.
Molecular Mass : 17 kDa
AA Sequence : HHHHHHHHSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSE MIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSE FDIFINYIEAYMTMKIRN
Endotoxin : < 0.04="" eu/μg="" protein="" (lal="">
Purity : >97% by SDS-PAGE gel
Storage : This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C. Repeated freezing and thawing is not recommended.
Reconstitution : Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 100 ng/μl. Due to the protein nature, dimmers and multimers may be observed. Optimal concentration should be determined for specific application and cell lines.
Gene Name IL10 interleukin 10 [ Homo sapiens ]
Official Symbol IL10
Synonyms IL10; interleukin 10; interleukin-10; CSIF; cytokine synthesis inhibitory factor; IL 10; IL10A; T cell growth inhibitory factor; TGIF; T-cell growth inhibitory factor; GVHDS; IL-10; MGC126450; MGC126451;
Gene ID 3586
mRNA Refseq NM_000572
Protein Refseq NP_000563
MIM 124092
UniProt ID P22301
Chromosome Location 1q31-q32
Pathway African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Asthma, organism-specific biosystem;
Function cytokine activity; growth factor activity; interleukin-10 receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL10 Products

Required fields are marked with *

My Review for All IL10 Products

Required fields are marked with *

0
cart-icon