Recombinant Rhesus monkey IL10 protein, His-tagged

Cat.No. : IL10-20R
Product Overview : Recombinant Rhesus monkey IL10 protein is produced by E.coli expression system and is fused with a His tag at the N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhesus macaque
Source : E.coli
Tag : His
Protein Length : Ser19-Asn178
Form : 100 mM NaHCO3, 500 mM NaCl, pH 8.3, containing 1 mM EDTA, 1 mM DTT, 0.01 % SKL, 5 % Trehalose and Proclin 300.
Molecular Mass : 23 kDa
AA Sequence : SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN
Endotoxin : <1.0EU per 1µg (determined by the LAL method)
Purity : > 90 %, by SDS-PAGE with Coomassie Brilliant Blue staining.
Applications : Positive Control; Immunogen; SDS-PAGE; WB.
Notes : Avoid repeated freeze/thaw cycles.
Stability : The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48 h, and no obvious degradation and precipitation were observed. The loss rate is less than 5 % within the expiration date under appropriate storage condition.
Storage : Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months.
Reconstitution : Reconstitute in 100mM NaHCO3, 500mM NaCl (pH8.3) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Gene Name IL10 interleukin 10 [ Macaca mulatta ]
Official Symbol IL10
Synonyms CSIF; IL10A; TGIF; Cytokine Synthesis Inhibitory Factor; interleukin 10;
Gene ID 694931
mRNA Refseq NM_001044727
Protein Refseq NP_001038192

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL10 Products

Required fields are marked with *

My Review for All IL10 Products

Required fields are marked with *

0
cart-icon
0
compare icon