Recombinant Human IL10RB Protein, His (Fc)-Avi tagged, Biotinylated

Cat.No. : IL10RB-4431H
Product Overview : Biotinylated Recombinant Human IL10RB Protein with His (Fc)-Avi tag was expressed in HEK293.
Availability December 17, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Avi&Fc&His
Description : The protein encoded by this gene belongs to the cytokine receptor family. It is an accessory chain essential for the active interleukin 10 receptor complex. Coexpression of this and IL10RA proteins has been shown to be required for IL10-induced signal transduction. This gene and three other interferon receptor genes, IFAR2, IFNAR1, and IFNGR2, form a class II cytokine receptor gene cluster located in a small region on chromosome 21.
Molecular Mass : The protein has a calculated MW of 50 kDa.
AA Sequence : MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 85% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.323 mg/mL by BCA
Storage Buffer : Sterile PBS, pH 7.4
Conjugation : Biotin
Gene Name IL10RB interleukin 10 receptor, beta [ Homo sapiens ]
Official Symbol IL10RB
Synonyms IL10RB; interleukin 10 receptor, beta; CRFB4, D21S58, D21S66; interleukin-10 receptor subunit beta; CDW210B; CRF2 4; IL 10R2; IL-10RB; IL-10R subunit 2; IL-10R subunit beta; IL-10 receptor subunit beta; cytokine receptor class-II CRF2-4; interleukin-10 receptor subunit 2; cytokine receptor class-II member 4; cytokine receptor family 2 member 4; cytokine receptor family II, member 4; CRFB4; CRF2-4; D21S58; D21S66; IL-10R2;
Gene ID 3588
mRNA Refseq NM_000628
Protein Refseq NP_000619
MIM 123889
UniProt ID Q08334

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL10RB Products

Required fields are marked with *

My Review for All IL10RB Products

Required fields are marked with *

0
cart-icon
0
compare icon