Recombinant Human IL10RB Protein, His (Fc)-Avi tagged, Biotinylated
Cat.No. : | IL10RB-4431H |
Product Overview : | Biotinylated Recombinant Human IL10RB Protein with His (Fc)-Avi tag was expressed in HEK293. |
Availability | September 16, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Avi&Fc&His |
Description : | The protein encoded by this gene belongs to the cytokine receptor family. It is an accessory chain essential for the active interleukin 10 receptor complex. Coexpression of this and IL10RA proteins has been shown to be required for IL10-induced signal transduction. This gene and three other interferon receptor genes, IFAR2, IFNAR1, and IFNGR2, form a class II cytokine receptor gene cluster located in a small region on chromosome 21. |
Molecular Mass : | The protein has a calculated MW of 50 kDa. |
AA Sequence : | MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 85% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.323 mg/mL by BCA |
Storage Buffer : | Sterile PBS, pH 7.4 |
Conjugation : | Biotin |
Gene Name | IL10RB interleukin 10 receptor, beta [ Homo sapiens ] |
Official Symbol | IL10RB |
Synonyms | IL10RB; interleukin 10 receptor, beta; CRFB4, D21S58, D21S66; interleukin-10 receptor subunit beta; CDW210B; CRF2 4; IL 10R2; IL-10RB; IL-10R subunit 2; IL-10R subunit beta; IL-10 receptor subunit beta; cytokine receptor class-II CRF2-4; interleukin-10 receptor subunit 2; cytokine receptor class-II member 4; cytokine receptor family 2 member 4; cytokine receptor family II, member 4; CRFB4; CRF2-4; D21S58; D21S66; IL-10R2; |
Gene ID | 3588 |
mRNA Refseq | NM_000628 |
Protein Refseq | NP_000619 |
MIM | 123889 |
UniProt ID | Q08334 |
◆ Recombinant Proteins | ||
IL10RB-4431HB | Recombinant Human IL10RB Protein, Fc-His-Avi-tagged, Biotinylated | +Inquiry |
IL10RB-1211H | Recombinant Human IL10RB Protein (Leu87-Ala243), N-His tagged | +Inquiry |
IL10RB-201H | Active Recombinant Human IL10RB, MIgG2a Fc-tagged | +Inquiry |
IL10RB-176H | Active Recombinant Human IL10RB protein(Met1-Ser220), His&hFc-tagged | +Inquiry |
IL10RB-6420C | Recombinant Chicken IL10RB | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10RB-1371RCL | Recombinant Rat IL10RB cell lysate | +Inquiry |
IL10RB-1795MCL | Recombinant Mouse IL10RB cell lysate | +Inquiry |
IL10RB-2677HCL | Recombinant Human IL10RB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL10RB Products
Required fields are marked with *
My Review for All IL10RB Products
Required fields are marked with *