Recombinant Human IL12RB2 protein, His-tagged
Cat.No. : | IL12RB2-3884H |
Product Overview : | Recombinant Human IL12RB2(24-622aa) fused with His tag was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 24-622aa |
Description : | This protein is a type I transmembrane protein identified as a subunit of the interleukin 12 receptor complex. The coex |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 69.7kD |
AA Sequence : | KIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCFHYSRRNKLILYKFDRRINFHHGHSLNSQVTGLPLGTTL FVCKLACINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQC KDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRD EGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHLYKGSWSDWSESLRAQTPEEEPTG MLDVWYMKRHIDYSRQQISLFWKNLSVSEARGKILHYQVTLQELTGGKAMTQNITGHTSWTTVIPRTGNWAVAVS AANSKGSSLPTRINIMNLCEAGLLAPRQVSANSEGMDNILVTWQPPRKDPSAVQEYVVEWRELHPGGDTQVPLNW LRSRPYNVSALISENIKSYICYEIRVYALSGDQGGCSSILGNSKHKAPLSGPHINAITEEKGSILISWNSIPVQE QMGCLLHYRIYWKERDSNSQPQLCEIPYRVSQNSHPINSLQPRVTYVLWMTALTAAGESSHGNEREFCLQGKAN |
Purity : | >90% ( SDS-PAGE ) |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. |
Gene Name | IL12RB2 interleukin 12 receptor, beta 2 [ Homo sapiens ] |
Official Symbol | IL12RB2 |
Synonyms | IL12RB2; interleukin 12 receptor, beta 2; interleukin-12 receptor subunit beta-2; IL-12RB2; IL-12R-beta-2; IL-12 receptor beta 2; IL-12R subunit beta-2; IL-12 receptor subunit beta-2; interleukin-12 receptor beta-2 chain; RP11-102M16.1; |
Gene ID | 3595 |
mRNA Refseq | NM_001258214 |
Protein Refseq | NP_001245143 |
MIM | 601642 |
UniProt ID | Q99665 |
Chromosome Location | 1p31.3-p31.2 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; IL12-mediated signaling events, organism-specific biosystem; IL27-mediated signaling events, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; |
Function | cytokine receptor activity; protein kinase binding; receptor activity; |
◆ Recombinant Proteins | ||
Il12rb2-1466M | Recombinant Mouse Il12rb2 protein, His-tagged | +Inquiry |
IL12RB2-3233H | Active Recombinant Human IL12RB2 protein, His-tagged | +Inquiry |
IL12RB2-214H | Recombinant Human IL12RB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL12RB2-1465H | Recombinant Human IL12RB2 protein, His & GST-tagged | +Inquiry |
IL12RB2-3885H | Recombinant Human IL12RB2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL12RB2-2142MCL | Recombinant Mouse IL12RB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL12RB2 Products
Required fields are marked with *
My Review for All IL12RB2 Products
Required fields are marked with *
0
Inquiry Basket