Recombinant Human IL12RB2 protein, His-tagged

Cat.No. : IL12RB2-3884H
Product Overview : Recombinant Human IL12RB2(24-622aa) fused with His tag was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 24-622aa
Description : This protein is a type I transmembrane protein identified as a subunit of the interleukin 12 receptor complex. The coexpression of this and IL12RB1 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. The expression of this gene is up-regulated by interferon gamma in Th1 cells, and plays a role in Th1 cell differentiation. The up-regulation of this gene is found to be associated with a number of infectious diseases, such as Crohn s disease and leprosy, which is thought to contribute to the inflammatory response and host defense.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 69.7kD
AA Sequence : KIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCFHYSRRNKLILYKFDRRINFHHGHSLNSQVTGLPLGTTL FVCKLACINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQC KDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRD EGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHLYKGSWSDWSESLRAQTPEEEPTG MLDVWYMKRHIDYSRQQISLFWKNLSVSEARGKILHYQVTLQELTGGKAMTQNITGHTSWTTVIPRTGNWAVAVS AANSKGSSLPTRINIMNLCEAGLLAPRQVSANSEGMDNILVTWQPPRKDPSAVQEYVVEWRELHPGGDTQVPLNW LRSRPYNVSALISENIKSYICYEIRVYALSGDQGGCSSILGNSKHKAPLSGPHINAITEEKGSILISWNSIPVQE QMGCLLHYRIYWKERDSNSQPQLCEIPYRVSQNSHPINSLQPRVTYVLWMTALTAAGESSHGNEREFCLQGKAN
Purity : >90% ( SDS-PAGE )
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade.
Gene Name IL12RB2 interleukin 12 receptor, beta 2 [ Homo sapiens ]
Official Symbol IL12RB2
Synonyms IL12RB2; interleukin 12 receptor, beta 2; interleukin-12 receptor subunit beta-2; IL-12RB2; IL-12R-beta-2; IL-12 receptor beta 2; IL-12R subunit beta-2; IL-12 receptor subunit beta-2; interleukin-12 receptor beta-2 chain; RP11-102M16.1;
Gene ID 3595
mRNA Refseq NM_001258214
Protein Refseq NP_001245143
MIM 601642
UniProt ID Q99665
Chromosome Location 1p31.3-p31.2
Pathway Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; IL12-mediated signaling events, organism-specific biosystem; IL27-mediated signaling events, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem;
Function cytokine receptor activity; protein kinase binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL12RB2 Products

Required fields are marked with *

My Review for All IL12RB2 Products

Required fields are marked with *

0
cart-icon