Recombinant Human IL17A protein(26-132aa), His-GST-tagged
| Cat.No. : | IL17A-1812H |
| Product Overview : | Recombinant Human IL17A protein(Q16552)(26-132aa), fused with N-terminal His and GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His |
| Protein Length : | 26-132aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 44.0 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | TIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNS |
| Gene Name | IL17A interleukin 17A [ Homo sapiens ] |
| Official Symbol | IL17A |
| Synonyms | IL17A; interleukin 17A; CTLA8, IL17, interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8); interleukin-17A; cytotoxic T lymphocyte associated protein 8; IL 17; IL 17A; CTLA-8; cytotoxic T-lymphocyte-associated antigen 8; cytotoxic T-lymphocyte-associated protein 8; cytotoxic T-lymphocyte-associated serine esterase 8; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); IL17; CTLA8; IL-17; IL-17A; |
| Gene ID | 3605 |
| mRNA Refseq | NM_002190 |
| Protein Refseq | NP_002181 |
| MIM | 603149 |
| UniProt ID | Q16552 |
| ◆ Recombinant Proteins | ||
| IL17A-182H | Active Recombinant Human IL17A Protein (Ile20-Ala155), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| Il17a-253I | Active Recombinant Mouse Il17a Protein (133 aa) | +Inquiry |
| IL17A-1008P | Recombinant Pig IL17A Protein, His-tagged | +Inquiry |
| IL17A-055C | Recombinant Cynomolgus IL17A(Gly24Ala155) Protein, C-6*His-tagged | +Inquiry |
| IL17A-97H | Recombinant Human IL-17A | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL17A-001HCL | Recombinant Human IL17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL17A Products
Required fields are marked with *
My Review for All IL17A Products
Required fields are marked with *
