Recombinant Human IL17A Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | IL17A-5856H |
| Product Overview : | IL17A MS Standard C13 and N15-labeled recombinant protein (NP_002181) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. |
| Molecular Mass : | 17.5 kDa |
| AA Sequence : | MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | IL17A interleukin 17A [ Homo sapiens (human) ] |
| Official Symbol | IL17A |
| Synonyms | IL17A; interleukin 17A; CTLA8, IL17, interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8); interleukin-17A; cytotoxic T lymphocyte associated protein 8; IL 17; IL 17A; CTLA-8; cytotoxic T-lymphocyte-associated antigen 8; cytotoxic T-lymphocyte-associated protein 8; cytotoxic T-lymphocyte-associated serine esterase 8; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); IL17; CTLA8; IL-17; IL-17A; |
| Gene ID | 3605 |
| mRNA Refseq | NM_002190 |
| Protein Refseq | NP_002181 |
| MIM | 603149 |
| UniProt ID | Q16552 |
| ◆ Recombinant Proteins | ||
| IL17A-903HFL | Recombinant Full Length Human IL17A Protein, C-Flag-tagged | +Inquiry |
| IL17A-333H | Active Recombinant Human IL17A | +Inquiry |
| IL17A-426H | Recombinant Human Interleukin 17A, His-tagged | +Inquiry |
| Il17a-105M | Active Recombinant Mouse Il17a protein | +Inquiry |
| IL17A-001H | Active Recombinant Mouse Interleukin 17A, MIgG2a Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL17A-001HCL | Recombinant Human IL17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL17A Products
Required fields are marked with *
My Review for All IL17A Products
Required fields are marked with *
