Recombinant Human IL17A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | IL17A-5856H |
Product Overview : | IL17A MS Standard C13 and N15-labeled recombinant protein (NP_002181) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. |
Molecular Mass : | 17.5 kDa |
AA Sequence : | MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | IL17A interleukin 17A [ Homo sapiens (human) ] |
Official Symbol | IL17A |
Synonyms | IL17A; interleukin 17A; CTLA8, IL17, interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8); interleukin-17A; cytotoxic T lymphocyte associated protein 8; IL 17; IL 17A; CTLA-8; cytotoxic T-lymphocyte-associated antigen 8; cytotoxic T-lymphocyte-associated protein 8; cytotoxic T-lymphocyte-associated serine esterase 8; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); IL17; CTLA8; IL-17; IL-17A; |
Gene ID | 3605 |
mRNA Refseq | NM_002190 |
Protein Refseq | NP_002181 |
MIM | 603149 |
UniProt ID | Q16552 |
◆ Recombinant Proteins | ||
IL17A-1812H | Recombinant Human IL17A protein(26-132aa), His-GST-tagged | +Inquiry |
IL17A-261R | Recombinant Rhesus IL17A protein(Met1-Ala155) | +Inquiry |
Il17a-149M | Recombinant Active Mouse IL17A Protein, His-tagged(C-ter) | +Inquiry |
Il17a-89R | Recombinant Rat Interleukin 17A | +Inquiry |
IL17A-001C | Recombinant Cynomolgus Monkey IL17A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17A-001HCL | Recombinant Human IL17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL17A Products
Required fields are marked with *
My Review for All IL17A Products
Required fields are marked with *
0
Inquiry Basket