Recombinant Human IL1B protein, GST-tagged
| Cat.No. : | IL1B-14167H |
| Product Overview : | Recombinant Human IL1B protein(1-269 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | July 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-269 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
| Gene Name | IL1B interleukin 1, beta [ Homo sapiens ] |
| Official Symbol | IL1B |
| Synonyms | IL1B; interleukin 1, beta; interleukin-1 beta; IL 1B; IL1 BETA; IL1F2; IL-1 beta; catabolin; preinterleukin 1 beta; pro-interleukin-1-beta; IL-1; IL1-BETA; |
| Gene ID | 3553 |
| mRNA Refseq | NM_000576 |
| Protein Refseq | NP_000567 |
| MIM | 147720 |
| UniProt ID | P01584 |
| ◆ Recombinant Proteins | ||
| IL1B-101I | Active Recombinant Human IL1B Protein (153 aa) | +Inquiry |
| Il1b-5314M | Recombinant Mouse Il1b protein, His-tagged | +Inquiry |
| Il1B-466H | Recombinant Human Il1B, HIgG1 Fc-tagged | +Inquiry |
| Il1b-105M | Recombinant Mouse Interleukin 1 Beta, His-tagged | +Inquiry |
| IL1B-366I | Active Recombinant Human IL1B Protein (153 aa) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1B Products
Required fields are marked with *
My Review for All IL1B Products
Required fields are marked with *
