| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
152 |
| Description : |
Interleukin-1 receptor antagonist (IL-1RA) is a member of the IL-1 family. IL1RA is secreted by various types of cells including immune cells, epithelial cells, and adipocytes, and is a natural inhibitor of the pro-inflammatory effect of IL1β. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. IL-4 and IL-13 have been shown to amplify the stimulatory effect of IL1-beta on the production of soluble and intracellular forms of IL1-RA. The regulated expression of IL1RA in various cell types has been shown to be influenced by cytokines. In synovial fibroblasts the synthesis of IL-1RA is markedly enhanced by IL-1, TNF-alpha, or PDGF. The protein shows 26 % amino acid homology to IL1β and 19 % homology to IL1α. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by inhibiting IL-1α-dependent proliferation of murine D10S cells is less than 40 ng/ml, corresponding to a specific activity of > 2.5 × 10⁴ IU/mg in the presence of 50 pg/ml rHuIL-1α. |
| Molecular Mass : |
Approximately 17.1 kDa, a single non-glycosylated polypeptide chain containing 152 amino acids. |
| AA Sequence : |
RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE |
| Endotoxin : |
Less than 1 EU/µg of rHuIL-1RA as determined by LAL method. |
| Purity : |
>96% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
| Publications : |
|