Recombinant Human IL21 Protein, GMP Grade, Animal-Free

• Cat.No.: IL21-37HG
• Product Overview: GMP Recombinant Human IL21 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 132 amino acid residues
• Description: IL-21 is a pleiotropic cytokine produced by CD4+ T cells in response to antigenic stimulation. Its action generally enhances antigen-specific responses of immune cells.
• Molecular Mass: 15.4 kDa
• AA Sequence: MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
• Purity: ≥ 98% by SDS-PAGE gel and HPLC analyses.

Gene Information

• Gene Name: IL21 interleukin 21 [ Homo sapiens (human) ]
• Official Symbol: IL21
• Synonyms: IL21; interleukin 21; interleukin-21; IL 21; Za11; interleukin-21 isoform; IL-21
• Gene ID: 59067
• mRNA Refseq: NM_001207006
• Protein Refseq: NP_001193935
• MIM: 605384
• UniProt ID: Q9HBE4