Recombinant Human IL21 Protein, GMP Grade, Animal-Free
| Cat.No. : | IL21-37HG |
| Product Overview : | GMP Recombinant Human IL21 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Protein Length : | 132 amino acid residues |
| Description : | IL-21 is a pleiotropic cytokine produced by CD4+ T cells in response to antigenic stimulation. Its action generally enhances antigen-specific responses of immune cells. |
| Molecular Mass : | 15.4 kDa |
| AA Sequence : | MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS |
| Purity : | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
| Gene Name | IL21 interleukin 21 [ Homo sapiens (human) ] |
| Official Symbol | IL21 |
| Synonyms | IL21; interleukin 21; interleukin-21; IL 21; Za11; interleukin-21 isoform; IL-21; |
| Gene ID | 59067 |
| mRNA Refseq | NM_001207006 |
| Protein Refseq | NP_001193935 |
| MIM | 605384 |
| UniProt ID | Q9HBE4 |
| ◆ Recombinant Proteins | ||
| Il21-153M | Active Recombinant Mouse Il21 Protein | +Inquiry |
| Il21-844M | Active Recombinant Mouse Il21 protein | +Inquiry |
| IL21-022M | Active Recombinant Mouse IL21, MIgG2a Fc-tagged, mutant | +Inquiry |
| IL21-3378R | Active Recombinant Rat IL21 protein(Met1-Ser146), His-tagged | +Inquiry |
| Il21-001H | Active Recombinant Human Il21, HIgG1 Fc-tagged, mutant | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL21-001RCL | Recombinant Rat IL21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL21 Products
Required fields are marked with *
My Review for All IL21 Products
Required fields are marked with *



