Recombinant Human IL21 Protein, GMP Grade, Animal-Free

Cat.No. : IL21-37HG
Product Overview : GMP Recombinant Human IL21 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 132 amino acid residues
Description : IL-21 is a pleiotropic cytokine produced by CD4+ T cells in response to antigenic stimulation. Its action generally enhances antigen-specific responses of immune cells.
Molecular Mass : 15.4 kDa
AA Sequence : MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Purity : ≥ 98% by SDS-PAGE gel and HPLC analyses.
Gene Name IL21 interleukin 21 [ Homo sapiens (human) ]
Official Symbol IL21
Synonyms IL21; interleukin 21; interleukin-21; IL 21; Za11; interleukin-21 isoform; IL-21;
Gene ID 59067
mRNA Refseq NM_001207006
Protein Refseq NP_001193935
MIM 605384
UniProt ID Q9HBE4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL21 Products

Required fields are marked with *

My Review for All IL21 Products

Required fields are marked with *

0
cart-icon