Recombinant Human IL21 Protein, GMP Grade, Animal-Free
Cat.No. : | IL21-37HG |
Product Overview : | GMP Recombinant Human IL21 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 132 amino acid residues |
Description : | IL-21 is a pleiotropic cytokine produced by CD4+ T cells in response to antigenic stimulation. Its action generally enhances antigen-specific responses of immune cells. |
Molecular Mass : | 15.4 kDa |
AA Sequence : | MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS |
Purity : | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
Gene Name | IL21 interleukin 21 [ Homo sapiens (human) ] |
Official Symbol | IL21 |
Synonyms | IL21; interleukin 21; interleukin-21; IL 21; Za11; interleukin-21 isoform; IL-21; |
Gene ID | 59067 |
mRNA Refseq | NM_001207006 |
Protein Refseq | NP_001193935 |
MIM | 605384 |
UniProt ID | Q9HBE4 |
◆ Cell & Tissue Lysates | ||
IL21-001RCL | Recombinant Rat IL21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL21 Products
Required fields are marked with *
My Review for All IL21 Products
Required fields are marked with *
0
Inquiry Basket