Recombinant Human IL23 Protein, His tagged

• Cat.No.: IL23A&IL12B-01HFL
• Product Overview: Recombinant human IL23 p40 and p19, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Protein Length: p40: 23-328 aa p19: 20-189 aa
• Description: IL23 p40 and p19, also known as interleukin-12 subunit beta/interleukin-23 subunit alpha, is a heterodimeric cytokine composed of two disulfide-linked subunit, a p19 subunit that is unique to IL23, and a p40 subunit that is shared with IL12. The p19 subunit has homology to the p35 subunit of IL12, as well as to other single chain sytokines sub as IL6 and IL11. It is produced by macrophages and B lymphocytes and has multiple effects on T cells and NK cells, including stimulation of cytotoxic activity, proliferation, and promotion of Th1 development as well as IFN-gamma and TNF production. Recombinant human IL23 p40 and p19, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
• Form: Liquid
• AASequence: IL12B (p40): IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS IL23A (p19): RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
• Molecular Mass: p40: 34.6 kDa p19: 19.5 kDa
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 95% by SDS-PAGE
• Application: SDS-PAGE
• Note: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
• Concentration: 1 mg/mL (determined by absorbance at 280nm)

Gene Information

• Gene Name: IL23A interleukin 23 subunit alpha [ Homo sapiens (human) ]
• Official Symbol: IL23A interleukin 23 subunit alpha [ Homo sapiens (human) ]
• Synonyms: IL23A; interleukin 23 subunit alpha; P19; SGRF; IL-23; IL-23A; IL23P19
• Gene ID: 51561
• mRNA Refseq: NM_016584
• Protein Refseq: NP_057668
• MIM: 605580
• UniProt ID: Q9NPF7
• Gene Name 2: IL12B interleukin 12B [ Homo sapiens (human) ]
• Official Symbol 2: IL12B
• Synonyms 2: IL12B; interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40); NKSF2; interleukin-12 subunit beta; CLMF; CLMF2; cytotoxic lymphocyte maturation factor 2; p40; IL 12B; IL12; subunit p40; interleukin 12; interleukin 12 beta chain; natural killer cell stimulatory factor; 40 kD subunit; natural killer cell stimulatory factor 2; NKSF; CLMF p40; IL-12 subunit p40; IL12, subunit p40; interleukin 12, p40; interleukin-12 beta chain; NK cell stimulatory factor chain 2; cytotoxic lymphocyte maturation factor 40 kDa subunit; natural killer cell stimulatory factor, 40 kD subunit; IL-12B
• Gene ID 2: 3593
• mRNA Refseq 2: NM_002187
• Protein Refseq 2: NP_002178
• MIM 2: 161561
• UniProt ID 2: P29460