Recombinant Human IL23 Protein, His tagged

Cat.No. : IL23A&IL12B-01HFL
Product Overview : Recombinant human IL23 p40 and p19, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : p40: 23-328 aa p19: 20-189 aa
Description : IL23 p40 and p19, also known as interleukin-12 subunit beta/interleukin-23 subunit alpha, is a heterodimeric cytokine composed of two disulfide-linked subunit, a p19 subunit that is unique to IL23, and a p40 subunit that is shared with IL12. The p19 subunit has homology to the p35 subunit of IL12, as well as to other single chain sytokines sub as IL6 and IL11. It is produced by macrophages and B lymphocytes and has multiple effects on T cells and NK cells, including stimulation of cytotoxic activity, proliferation, and promotion of Th1 development as well as IFN-gamma and TNF production. Recombinant human IL23 p40 and p19, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Form : Liquid
AASequence : IL12B (p40): IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS IL23A (p19): RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Molecular Mass : p40: 34.6 kDa p19: 19.5 kDa
Endotoxin : < 1 EU/μg by LAL
Purity : > 95% by SDS-PAGE
Application : SDS-PAGE
Note : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Concentration : 1 mg/mL (determined by absorbance at 280nm)
Gene Name IL23A interleukin 23 subunit alpha [ Homo sapiens (human) ]
Official Symbol IL23A interleukin 23 subunit alpha [ Homo sapiens (human) ]
Synonyms IL23A; interleukin 23 subunit alpha; P19; SGRF; IL-23; IL-23A; IL23P19
Gene ID 51561
mRNA Refseq NM_016584
Protein Refseq NP_057668
MIM 605580
UniProt ID Q9NPF7
Gene Name 2 IL12B interleukin 12B [ Homo sapiens (human) ]
Official Symbol 2 IL12B
Synonyms 2 IL12B; interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40); NKSF2; interleukin-12 subunit beta; CLMF; CLMF2; cytotoxic lymphocyte maturation factor 2; p40; IL 12B; IL12; subunit p40; interleukin 12; interleukin 12 beta chain; natural killer cell stimulatory factor; 40 kD subunit; natural killer cell stimulatory factor 2; NKSF; CLMF p40; IL-12 subunit p40; IL12, subunit p40; interleukin 12, p40; interleukin-12 beta chain; NK cell stimulatory factor chain 2; cytotoxic lymphocyte maturation factor 40 kDa subunit; natural killer cell stimulatory factor, 40 kD subunit; IL-12B;
Gene ID 2 3593
mRNA Refseq 2 NM_002187
Protein Refseq 2 NP_002178
MIM 2 161561
UniProt ID 2 P29460

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL12 Products

Required fields are marked with *

My Review for All IL12 Products

Required fields are marked with *

0
cart-icon
0
compare icon