Recombinant Human Il23A Protein, GST-tagged
| Cat.No. : | Il23A-053H |
| Product Overview : | Human IL23A full-length ORF ( NP_057668.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-gamma (IFNG). In contrast to IL12, which acts mainly on naive CD4(+) T cells, IL23 preferentially acts on memory CD4(+) T cells. |
| Molecular Mass : | 47.1 kDa |
| AA Sequence : | MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | IL23A interleukin 23 subunit alpha [ Homo sapiens (human) ] |
| Official Symbol | IL23A |
| Synonyms | IL23A; interleukin 23 subunit alpha; P19; SGRF; IL-23; IL-23A; IL23P19; interleukin-23 subunit alpha; IL-23 subunit alpha; IL-23-A; IL-23p19; JKA3 induced upon T-cell activation; interleukin 23 p19 subunit; interleukin 23, alpha subunit p19; interleukin-23 subunit p19; interleukin-six, G-CSF related factor |
| Gene ID | 51561 |
| mRNA Refseq | NM_016584 |
| Protein Refseq | NP_057668 |
| MIM | 605580 |
| UniProt ID | Q9NPF7 |
| ◆ Recombinant Proteins | ||
| IL23a-3326R | Recombinant Rat IL23a protein, His-tagged | +Inquiry |
| Il23A-053H | Recombinant Human Il23A Protein, GST-tagged | +Inquiry |
| IL23A-8156M | Recombinant Mouse IL23A Protein | +Inquiry |
| IL23A-01H | Active Recombinant Human IL23A Protein, Myc/DDK-tagged | +Inquiry |
| Il23a-3515M | Active Recombinant Mouse Il23a Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL23A-5231HCL | Recombinant Human IL23A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (1)
Ask a Question for All Il23A Products
Required fields are marked with *
My Review for All Il23A Products
Required fields are marked with *