Recombinant Human Il23A Protein, GST-tagged

Cat.No. : Il23A-053H
Product Overview : Human IL23A full-length ORF ( NP_057668.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-gamma (IFNG). In contrast to IL12, which acts mainly on naive CD4(+) T cells, IL23 preferentially acts on memory CD4(+) T cells.
Molecular Mass : 47.1 kDa
AA Sequence : MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IL23A interleukin 23 subunit alpha [ Homo sapiens (human) ]
Official Symbol IL23A
Synonyms IL23A; interleukin 23 subunit alpha; P19; SGRF; IL-23; IL-23A; IL23P19; interleukin-23 subunit alpha; IL-23 subunit alpha; IL-23-A; IL-23p19; JKA3 induced upon T-cell activation; interleukin 23 p19 subunit; interleukin 23, alpha subunit p19; interleukin-23 subunit p19; interleukin-six, G-CSF related factor
Gene ID 51561
mRNA Refseq NM_016584
Protein Refseq NP_057668
MIM 605580
UniProt ID Q9NPF7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (1)

Customer Reviews

Write a review

Q&As

Ask a question

Is this bioactive cyno IL-23 heterodimer (p19/p40) or just the cyno IL-23p19 subunit? 02/01/2023

Please inquiry our product manager with specific product.

Ask a Question for All Il23A Products

Required fields are marked with *

My Review for All Il23A Products

Required fields are marked with *

0
cart-icon