Recombinant Human IL23A Protein, MBP&His-tagged

• Cat.No.: IL23A-4844H
• Product Overview: Recombinant Human IL23A Protein(Q9NPF7)(20-189 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&MBP
• Protein Length: 20-189 aa
• Form: Phosphate buffered saline.
• Molecular Mass: 61 kDa
• AASequence: RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
• Storage: Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: IL23A interleukin 23, alpha subunit p19 [ Homo sapiens ]
• Official Symbol: IL23A
• Synonyms: IL23A; interleukin 23, alpha subunit p19; interleukin-23 subunit alpha; IL 23; IL 23A; IL23P19; interleukin six; G CSF related factor; P19; SGRF; IL-23-A; IL-23p19; IL-23 subunit alpha; interleukin 23 p19 subunit; interleukin-23 subunit p19; JKA3 induced upon T-cell activation; interleukin-six, G-CSF related factor; IL-23; IL-23A; MGC79388
• Gene ID: 51561
• mRNA Refseq: NM_016584
• Protein Refseq: NP_057668
• MIM: 605580
• UniProt ID: Q9NPF7

Q&As

Is this bioactive cyno IL-23 heterodimer (p19/p40) or just the cyno IL-23p19 subunit?

Please inquiry our product manager with specific product.