Recombinant Human IL23A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | IL23A-638H |
Product Overview : | IL23A MS Standard C13 and N15-labeled recombinant protein (NP_057668) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-gamma (IFNG). In contrast to IL12, which acts mainly on naive CD4(+) T cells, IL23 preferentially acts on memory CD4(+) T cells. |
Molecular Mass : | 20.8 kDa |
AA Sequence : | MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQMPSLSPSQPWQRLLLRFKILRNLQAFVAVAARVFAHGAATLSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | IL23A interleukin 23 subunit alpha [ Homo sapiens (human) ] |
Official Symbol | IL23A |
Synonyms | IL23A; interleukin 23, alpha subunit p19; interleukin-23 subunit alpha; IL 23; IL 23A; IL23P19; interleukin six; G CSF related factor; P19; SGRF; IL-23-A; IL-23p19; IL-23 subunit alpha; interleukin 23 p19 subunit; interleukin-23 subunit p19; JKA3 induced upon T-cell activation; interleukin-six, G-CSF related factor; IL-23; IL-23A; MGC79388; |
Gene ID | 51561 |
mRNA Refseq | NM_016584 |
Protein Refseq | NP_057668 |
MIM | 605580 |
UniProt ID | Q9NPF7 |
◆ Recombinant Proteins | ||
IL23a-3326R | Recombinant Rat IL23a protein, His-tagged | +Inquiry |
IL23A-553H | Recombinant Human IL23A protein, His-tagged | +Inquiry |
Il23a-1927M | Recombinant Mouse Il23a Protein | +Inquiry |
Il23A-23H | Recombinant Human Il23A&IL12B Protein, His-tagged | +Inquiry |
IL23A-966H | Active Recombinant Human IL23A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL23A-5231HCL | Recombinant Human IL23A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (1)
Ask a question
Is this bioactive cyno IL-23 heterodimer (p19/p40) or just the cyno IL-23p19 subunit?
02/01/2023
Please inquiry our product manager with specific product.
Ask a Question for All IL23A Products
Required fields are marked with *
My Review for All IL23A Products
Required fields are marked with *
0
Inquiry Basket