Recombinant Human IL24 Protein, GST-tagged
Cat.No. : | IL24-5211H |
Product Overview : | Human IL24 partial ORF ( AAH09681, 58 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq |
Molecular Mass : | 37.73 kDa |
AA Sequence : | GPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IL24 interleukin 24 [ Homo sapiens ] |
Official Symbol | IL24 |
Synonyms | IL24; interleukin 24; ST16; interleukin-24; C49A; FISP; IL 4 induced secreted protein; IL 24; IL10B; mda 7; melanoma differentiation association protein 7; Mob 5; suppression of tumorigenicity 16 (melanoma differentiation); melanocyte-associated Mda-7; IL-4-induced secreted protein; melanoma differentiation-associated gene 7 protein; MDA7; MOB5; |
Gene ID | 11009 |
mRNA Refseq | NM_001185156 |
Protein Refseq | NP_001172085 |
MIM | 604136 |
UniProt ID | Q13007 |
◆ Recombinant Proteins | ||
IL24-585H | Active Recombinant Human IL24, HIgG1 Fc-tagged, mutant | +Inquiry |
Il24-194R | Recombinant Rat Il24 Protein, His/GST-tagged | +Inquiry |
IL24-3042R | Recombinant Rat IL24 Protein | +Inquiry |
Il24-796M | Active Recombinant Mouse Il24 | +Inquiry |
IL24-1925H | Recombinant Human IL24 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL24-1922HCL | Recombinant Human IL24 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL24 Products
Required fields are marked with *
My Review for All IL24 Products
Required fields are marked with *
0
Inquiry Basket