Recombinant Human IL2RG, Fc-tagged
Cat.No. : | IL2RG-29663TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 23-259 of Human IL2 Receptor gamma fused to the Fc region of human IgG1 expressed in modified human 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Fc |
Protein Length : | 23-259 a.a. |
Description : | The protein encoded by this gene is an important signaling component of many interleukin receptors, including those of interleukin -2, -4, -7 and -21, and is thus referred to as the common gamma chain. Mutations in this gene cause X-linked severe combined immunodeficiency (XSCID), as well as X-linked combined immunodeficiency (XCID), a less severe immunodeficiency disorder. |
Conjugation : | Fc |
Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin |
Storage : | Store at +4°C. |
Sequences of amino acids : | Theoretical Sequence:LNTTILTPNGNEDTTADFFLTTMPTDSLS VSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHY WYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQT FVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYR HKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHP IHWGSNTSKENPFLFAWIPKVDKKVEPKSCDKTHTCPP CPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPR EPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWE SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPGK |
Gene Name | IL2RG interleukin 2 receptor, gamma [ Homo sapiens ] |
Official Symbol | IL2RG |
Synonyms | IL2RG; interleukin 2 receptor, gamma; CIDX, combined immunodeficiency, X linked , IMD4, SCIDX1, severe combined immunodeficiency; cytokine receptor common subunit gamma; CD132; |
Gene ID | 3561 |
mRNA Refseq | NM_000206 |
Protein Refseq | NP_000197 |
MIM | 308380 |
Uniprot ID | P31785 |
Chromosome Location | Xq13 |
Pathway | Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Downstream signaling in naive CD8+ T cells, organism-specific biosystem; Endocytosis, organism-specific biosystem; |
Function | cytokine receptor activity; interleukin-2 binding; contributes_to interleukin-2 receptor activity; contributes_to interleukin-4 receptor activity; contributes_to interleukin-7 receptor activity; |
◆ Recombinant Proteins | ||
RFL33937HF | Recombinant Full Length Human Cytokine Receptor Common Subunit Gamma(Il2Rg) Protein, His-Tagged | +Inquiry |
IL2RG-151H | Recombinant Human IL2RG Protein, His-tagged | +Inquiry |
IL2RG-7066H | Recombinant Human IL2RG protein, His-tagged | +Inquiry |
IL2RG-0170C | Recombinant Cynomolgus IL2RG protein, His-tagged | +Inquiry |
IL2RG-14197H | Recombinant Human IL2RG Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL2RG-1481HCL | Recombinant Human IL2RG cell lysate | +Inquiry |
IL2RG-502HCL | Recombinant Human IL2RG cell lysate | +Inquiry |
IL2RG-1476RCL | Recombinant Rat IL2RG cell lysate | +Inquiry |
IL2RG-2908MCL | Recombinant Mouse IL2RG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL2RG Products
Required fields are marked with *
My Review for All IL2RG Products
Required fields are marked with *
0
Inquiry Basket