Recombinant Human IL2RG, Fc-tagged IL2RG-29663TH

Recombinant Human IL2RG, Fc-tagged

PRODUCTS

Home / Products / Others / Recombinant Human IL2RG, Fc-tagged

Recombinant Human IL2RG, Fc-tagged

Online Inquiry

IL2RG Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : IL2RG-29663TH Optional Service: Optional requirements on this protein
Product Overview : Recombinant fragment, corresponding to amino acids 23-259 of Human IL2 Receptor gamma fused to the Fc region of human IgG1 expressed in modified human 293 cells.
Description : The protein encoded by this gene is an important signaling component of many interleukin receptors, including those of interleukin -2, -4, -7 and -21, and is thus referred to as the common gamma chain. Mutations in this gene cause X-linked severe combined immunodeficiency (XSCID), as well as X-linked combined immunodeficiency (XCID), a less severe immunodeficiency disorder.
Conjugation : Fc
Form : Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage : Store at +4°C.
Sequences of amino acids : Theoretical Sequence:LNTTILTPNGNEDTTADFFLTTMPTDSLS VSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHY WYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQT FVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYR HKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHP IHWGSNTSKENPFLFAWIPKVDKKVEPKSCDKTHTCPP CPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPR EPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWE SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPGK
Gene Name : IL2RG interleukin 2 receptor, gamma [ Homo sapiens ]
Official Symbol : IL2RG
Synonyms : IL2RG; interleukin 2 receptor, gamma; CIDX, combined immunodeficiency, X linked , IMD4, SCIDX1, severe combined immunodeficiency; cytokine receptor common subunit gamma; CD132;
Gene ID : 3561
mRNA Refseq : NM_000206
Protein Refseq : NP_000197
MIM : 308380
Uniprot ID : P31785
Chromosome Location : Xq13
Pathway : Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Downstream signaling in naive CD8+ T cells, organism-specific biosystem; Endocytosis, organism-specific biosystem;
Function : cytokine receptor activity; interleukin-2 binding; contributes_to interleukin-2 receptor activity; contributes_to interleukin-4 receptor activity; contributes_to interleukin-7 receptor activity;
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry


  • Note: There will be extra charge for optional service!

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2023 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy