Recombinant Human IL2RG Protein, GST-tagged
| Cat.No. : | IL2RG-5193H | 
| Product Overview : | Human IL2RG full-length ORF ( AAH14972, 1 a.a. - 369 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | The interleukin 2 (IL2) receptor gamma chain (IL2RG), an important signalling component of many interleukin receptors (IL2,IL4,IL7,IL9, and IL15), is thus referred to as the common gamma chain. Mutations in this X-chromosome-linked gene cause X-linked severe combined immunodeficiency (XSCID). [provided by RefSeq | 
| Molecular Mass : | 66.33 kDa | 
| AA Sequence : | MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array  | 
                                
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | IL2RG interleukin 2 receptor, gamma [ Homo sapiens ] | 
| Official Symbol | IL2RG | 
| Synonyms | IL2RG; interleukin 2 receptor, gamma; CIDX, combined immunodeficiency, X linked , IMD4, SCIDX1, severe combined immunodeficiency; cytokine receptor common subunit gamma; CD132; gammaC; gamma(c); CD132 antigen; common gamma-chain; IL-2R subunit gamma; IL-2 receptor subunit gamma; severe combined immunodeficiency; combined immunodeficiency, X-linked; common cytokine receptor gamma chain; interleukin-2 receptor subunit gamma; P64; CIDX; IMD4; SCIDX; IL-2RG; SCIDX1; | 
| Gene ID | 3561 | 
| mRNA Refseq | NM_000206 | 
| Protein Refseq | NP_000197 | 
| MIM | 308380 | 
| UniProt ID | P31785 | 
| ◆ Recombinant Proteins | ||
| Il2rg-784M | Recombinant Mouse Il2rg protein, His&hFc-tagged | +Inquiry | 
| IL2RG-151H | Recombinant Human IL2RG Protein, His-tagged | +Inquiry | 
| IL2RG-49H | Recombinant Human IL2RG, His-tagged | +Inquiry | 
| IL2RG-034R | Recombinant Rhesus IL2RG protein, hFc-tagged | +Inquiry | 
| IL2RG-3369P | Recombinant Pig IL2RG protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| IL2RG-502HCL | Recombinant Human IL2RG cell lysate | +Inquiry | 
| IL2RG-1476RCL | Recombinant Rat IL2RG cell lysate | +Inquiry | 
| IL2RG-1481HCL | Recombinant Human IL2RG cell lysate | +Inquiry | 
| IL2RG-2908MCL | Recombinant Mouse IL2RG cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All IL2RG Products
Required fields are marked with *
My Review for All IL2RG Products
Required fields are marked with *
  
        
    
      
            