Recombinant Human IL2RG protein(56-254aa(N75Q)), His-tagged
Cat.No. : | IL2RG-2918H |
Product Overview : | Recombinant Human IL2RG protein(P31785)(56-254aa(N75Q)), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 56-254aa(N75Q) |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.6 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | PLPEVQCFVFNVEYMNCTWQSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN |
Gene Name | IL2RG interleukin 2 receptor, gamma [ Homo sapiens ] |
Official Symbol | IL2RG |
Synonyms | IL2RG; interleukin 2 receptor, gamma; CIDX, combined immunodeficiency, X linked , IMD4, SCIDX1, severe combined immunodeficiency; cytokine receptor common subunit gamma; CD132; gammaC; gamma(c); CD132 antigen; common gamma-chain; IL-2R subunit gamma; IL-2 receptor subunit gamma; severe combined immunodeficiency; combined immunodeficiency, X-linked; common cytokine receptor gamma chain; interleukin-2 receptor subunit gamma; P64; CIDX; IMD4; SCIDX; IL-2RG; SCIDX1; |
Gene ID | 3561 |
mRNA Refseq | NM_000206 |
Protein Refseq | NP_000197 |
MIM | 308380 |
UniProt ID | P31785 |
◆ Recombinant Proteins | ||
Il2rg-7067M | Recombinant Mouse Il2rg protein, His-tagged | +Inquiry |
IL2RG-6096C | Recombinant Chicken IL2RG | +Inquiry |
IL2RG-0171M | Recombinant Mouse IL2RG protein, His-tagged | +Inquiry |
IL2RG-067H | Recombinant Human IL2RG Protein, C-His-tagged | +Inquiry |
IL2RG-0172H | Recombinant Human IL2RG protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL2RG-2908MCL | Recombinant Mouse IL2RG cell lysate | +Inquiry |
IL2RG-1481HCL | Recombinant Human IL2RG cell lysate | +Inquiry |
IL2RG-502HCL | Recombinant Human IL2RG cell lysate | +Inquiry |
IL2RG-1476RCL | Recombinant Rat IL2RG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL2RG Products
Required fields are marked with *
My Review for All IL2RG Products
Required fields are marked with *
0
Inquiry Basket