Recombinant Human IL2RG protein(56-254aa(N75Q)), His-tagged
| Cat.No. : | IL2RG-2918H |
| Product Overview : | Recombinant Human IL2RG protein(P31785)(56-254aa(N75Q)), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 56-254aa(N75Q) |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 26.6 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | PLPEVQCFVFNVEYMNCTWQSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN |
| Gene Name | IL2RG interleukin 2 receptor, gamma [ Homo sapiens ] |
| Official Symbol | IL2RG |
| Synonyms | IL2RG; interleukin 2 receptor, gamma; CIDX, combined immunodeficiency, X linked , IMD4, SCIDX1, severe combined immunodeficiency; cytokine receptor common subunit gamma; CD132; gammaC; gamma(c); CD132 antigen; common gamma-chain; IL-2R subunit gamma; IL-2 receptor subunit gamma; severe combined immunodeficiency; combined immunodeficiency, X-linked; common cytokine receptor gamma chain; interleukin-2 receptor subunit gamma; P64; CIDX; IMD4; SCIDX; IL-2RG; SCIDX1; |
| Gene ID | 3561 |
| mRNA Refseq | NM_000206 |
| Protein Refseq | NP_000197 |
| MIM | 308380 |
| UniProt ID | P31785 |
| ◆ Recombinant Proteins | ||
| IL2RG-1564R | Recombinant Rhesus Monkey IL2RG Protein, hIgG4-tagged | +Inquiry |
| IL2RG-895H | Recombinant Human IL2RG protein, His-Avi-tagged, Biotinylated(VLPs) | +Inquiry |
| IL2RG-3369P | Recombinant Pig IL2RG protein, His-tagged | +Inquiry |
| IL2RG-034R | Recombinant Rhesus IL2RG protein, hFc-tagged | +Inquiry |
| IL2RG-5193H | Recombinant Human IL2RG Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL2RG-502HCL | Recombinant Human IL2RG cell lysate | +Inquiry |
| IL2RG-1481HCL | Recombinant Human IL2RG cell lysate | +Inquiry |
| IL2RG-1476RCL | Recombinant Rat IL2RG cell lysate | +Inquiry |
| IL2RG-2908MCL | Recombinant Mouse IL2RG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL2RG Products
Required fields are marked with *
My Review for All IL2RG Products
Required fields are marked with *



