Recombinant Human IL3 protein, GST-tagged
Cat.No. : | IL3-3102H |
Product Overview : | Recombinant Human IL3 protein(P08700)(20-152aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 20-152aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.1 kDa |
AA Sequence : | APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | IL3 interleukin 3 (colony-stimulating factor, multiple) [ Homo sapiens ] |
Official Symbol | IL3 |
Synonyms | IL3; interleukin 3 (colony-stimulating factor, multiple); interleukin-3; hematopoietic growth factor; IL 3; mast cell growth factor; MCGF; MGC79398; MGC79399; MULTI CSF; multilineage colony stimulating factor; P cell stimulating factor; mast-cell growth factor; P-cell stimulating factor; P-cell-stimulating factor; multilineage-colony-stimulating factor; multipotential colony-stimulating factor; IL-3; MULTI-CSF; |
Gene ID | 3562 |
mRNA Refseq | NM_000588 |
Protein Refseq | NP_000579 |
MIM | 147740 |
UniProt ID | P08700 |
◆ Recombinant Proteins | ||
Il3-640M | Recombinant Mouse Il3 protein, His & T7-tagged | +Inquiry |
Il3-591R | Recombinant Rat Interleukin 3 | +Inquiry |
IL3-168H | Active Recombinant Human IL3 Protein | +Inquiry |
IL3-1556H | Recombinant human IL3, Active, His-tagged | +Inquiry |
IL3-200H | Active Recombinant Human IL3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL3-445RCL | Recombinant Rat IL3 cell lysate | +Inquiry |
IL3-607HCL | Recombinant Human IL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL3 Products
Required fields are marked with *
My Review for All IL3 Products
Required fields are marked with *