Recombinant Human IL3 protein, GST-tagged
| Cat.No. : | IL3-3102H |
| Product Overview : | Recombinant Human IL3 protein(P08700)(20-152aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 20-152aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 42.1 kDa |
| AA Sequence : | APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | IL3 interleukin 3 (colony-stimulating factor, multiple) [ Homo sapiens ] |
| Official Symbol | IL3 |
| Synonyms | IL3; interleukin 3 (colony-stimulating factor, multiple); interleukin-3; hematopoietic growth factor; IL 3; mast cell growth factor; MCGF; MGC79398; MGC79399; MULTI CSF; multilineage colony stimulating factor; P cell stimulating factor; mast-cell growth factor; P-cell stimulating factor; P-cell-stimulating factor; multilineage-colony-stimulating factor; multipotential colony-stimulating factor; IL-3; MULTI-CSF; |
| Gene ID | 3562 |
| mRNA Refseq | NM_000588 |
| Protein Refseq | NP_000579 |
| MIM | 147740 |
| UniProt ID | P08700 |
| ◆ Recombinant Proteins | ||
| Il3-1037R | Active Recombinant Rat Il3 protein, His-tagged | +Inquiry |
| IL3-2071R | Recombinant Rhesus Macaque IL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| IL3-168H | Active Recombinant Human IL3 Protein | +Inquiry |
| IL3-362D | Recombinant Dog Interleukin 3 (colony-stimulating factor, multiple) | +Inquiry |
| Il3-1922H | Recombinant Human Il3 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL3-607HCL | Recombinant Human IL3 cell lysate | +Inquiry |
| IL3-445RCL | Recombinant Rat IL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL3 Products
Required fields are marked with *
My Review for All IL3 Products
Required fields are marked with *



