Recombinant Human IL32 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | IL32-3824H |
Product Overview : | IL32 MS Standard C13 and N15-labeled recombinant protein (NP_001012736) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the cytokine family. The protein contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Expression of this protein is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2. This protein induces the production of TNFalpha from macrophage cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Molecular Mass : | 21.7 kDa |
AA Sequence : | MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | IL32 interleukin 32 [ Homo sapiens (human) ] |
Official Symbol | IL32 |
Synonyms | IL32; interleukin 32; interleukin-32; natural killer cell transcript 4; NK4; TAIF; TAIFb; TAIFd; interleukin-32 eta; interleukin-32 small; interleukin-32 theta; natural killer cells protein 4; tumor necrosis factor alpha-inducing factor; TAIFa; TAIFc; IL-32beta; IL-32alpha; IL-32delta; IL-32gamma; |
Gene ID | 9235 |
mRNA Refseq | NM_001012718 |
Protein Refseq | NP_001012736 |
MIM | 606001 |
UniProt ID | P24001 |
◆ Recombinant Proteins | ||
IL32-419H | Active Recombinant Human IL32 | +Inquiry |
IL32-5300H | Recombinant Human IL32 Protein (Met1-Lys234), C-His tagged | +Inquiry |
IL32-190H | Recombinant Active Human IL32 Protein, His-tagged(C-ter) | +Inquiry |
IL32-5778HF | Recombinant Full Length Human IL32 Protein, GST-tagged | +Inquiry |
IL32-20H | Recombinant Human IL32 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL32-2743HCL | Recombinant Human IL32 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL32 Products
Required fields are marked with *
My Review for All IL32 Products
Required fields are marked with *