Recombinant Human IL36RN Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | IL36RN-5462H |
Product Overview : | IL1F5 MS Standard C13 and N15-labeled recombinant protein (NP_775262) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported. |
Molecular Mass : | 17 kDa |
AA Sequence : | MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | IL36RN interleukin 36 receptor antagonist [ Homo sapiens (human) ] |
Official Symbol | IL36RN |
Synonyms | IL36RN; interleukin 36 receptor antagonist; IL1F5, interleukin 1 family, member 5 (delta); interleukin-36 receptor antagonist protein; family of interleukin 1 delta; FIL1; FIL1(DELTA); FIL1D; IL 1 related protein 3; IL 1F5; IL1HY1; IL1L1; IL1RP3; IL36RA; interleukin 1 HY1; interleukin 1 receptor antagonist homolog 1; MGC29840; IL-1ra homolog 1; interleukin-1 HY1; IL-1 related protein 3; interleukin-1-like protein 1; family of interleukin 1-delta; IL1F5 (Canonical product IL-1F5a); interleukin 1 family, member 5 (delta); interleukin-1 receptor antagonist homolog 1; IL-1F5 (IL-1HY1, FIL1-delta, IL-1RP3, IL-1L1, IL-1-delta); IL1F5; PSORP; |
Gene ID | 26525 |
mRNA Refseq | NM_173170 |
Protein Refseq | NP_775262 |
MIM | 605507 |
UniProt ID | Q9UBH0 |
◆ Recombinant Proteins | ||
IL36RN-5788HF | Recombinant Full Length Human IL36RN Protein, GST-tagged | +Inquiry |
Il1f5-148M | Active Recombinant Mouse Il1f5 Protein | +Inquiry |
IL36RN-5660H | Active Recombinant Human Interleukin 36 Receptor Antagonist | +Inquiry |
IL36RN-118H | Active Recombinant Human IL36RN Protein (Met1-Asp155), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IL36RN-5185H | Recombinant Human IL36RN Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL36RN-5240HCL | Recombinant Human IL1F5 293 Cell Lysate | +Inquiry |
IL36RN-5239HCL | Recombinant Human IL1F5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL36RN Products
Required fields are marked with *
My Review for All IL36RN Products
Required fields are marked with *