Recombinant Human IL36RN Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | IL36RN-5462H |
| Product Overview : | IL1F5 MS Standard C13 and N15-labeled recombinant protein (NP_775262) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported. |
| Molecular Mass : | 17 kDa |
| AA Sequence : | MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | IL36RN interleukin 36 receptor antagonist [ Homo sapiens (human) ] |
| Official Symbol | IL36RN |
| Synonyms | IL36RN; interleukin 36 receptor antagonist; IL1F5, interleukin 1 family, member 5 (delta); interleukin-36 receptor antagonist protein; family of interleukin 1 delta; FIL1; FIL1(DELTA); FIL1D; IL 1 related protein 3; IL 1F5; IL1HY1; IL1L1; IL1RP3; IL36RA; interleukin 1 HY1; interleukin 1 receptor antagonist homolog 1; MGC29840; IL-1ra homolog 1; interleukin-1 HY1; IL-1 related protein 3; interleukin-1-like protein 1; family of interleukin 1-delta; IL1F5 (Canonical product IL-1F5a); interleukin 1 family, member 5 (delta); interleukin-1 receptor antagonist homolog 1; IL-1F5 (IL-1HY1, FIL1-delta, IL-1RP3, IL-1L1, IL-1-delta); IL1F5; PSORP; |
| Gene ID | 26525 |
| mRNA Refseq | NM_173170 |
| Protein Refseq | NP_775262 |
| MIM | 605507 |
| UniProt ID | Q9UBH0 |
| ◆ Recombinant Proteins | ||
| IL1F5-14169H | Recombinant Human IL1F5, His-tagged | +Inquiry |
| IL36RN-2009H | Recombinant Human IL36RN Protein, His-tagged | +Inquiry |
| IL36RN-5185H | Recombinant Human IL36RN Protein, GST-tagged | +Inquiry |
| Il1f5-2836M | Recombinant Mouse Il1f5 protein, His & T7-tagged | +Inquiry |
| IL1F5-237B | Recombinant Bovine Interleukin 1 Family, Member 5 (Delta) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL36RN-5240HCL | Recombinant Human IL1F5 293 Cell Lysate | +Inquiry |
| IL36RN-5239HCL | Recombinant Human IL1F5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL36RN Products
Required fields are marked with *
My Review for All IL36RN Products
Required fields are marked with *
