"IL3RA" Related Products

Expand
Expand

Recombinant Human IL3RA protein, T7/His-tagged

Cat.No.: IL3RA-109H
Product Overview: Recombinant human CD123 cDNA (19-305 aa, derived from BC035407) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.2 mg/ml in sterile-filtered solution in 20 mM Tris, pH 7.5. Proprietary formulation of NaCl , KCl, EDTA, arginine, DTT, and glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVN NSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLY LNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMT AKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQ RFECDQEEGANTRAWR
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro CD123 mediated IL3 signaling regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for CD123 protein-protein interaction assay.3. Potential diagnostic biomarker for acute myeloid leukemia and lupus dieases.4. As antigen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: IL3RA interleukin 3 receptor, alpha (low affinity) [ Homo sapiens ]
Official Symbol: IL3RA
Synonyms: IL3RA; interleukin 3 receptor, alpha (low affinity); interleukin-3 receptor subunit alpha; CD123; IL-3RA; IL-3R-alpha; CD123 antigen; IL-3R subunit alpha; IL-3 receptor subunit alpha; IL-3 receptor alpha SP2 isoform; IL3R; IL3RX; IL3RY; IL3RAY; hIL-3Ra; M
Gene ID: 3563
mRNA Refseq: NM_002183
Protein Refseq: NP_002174
MIM: 308385
UniProt ID: P26951
Chromosome Location: Xp22.3 and Yp13.3
Pathway: Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem;
Function: interleukin-3 receptor activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.