Recombinant Human IL4R protein, His-tagged
| Cat.No. : | IL4R-3234H |
| Product Overview : | Recombinant Human IL4R protein(P24394)(24-232aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 24-232aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 30.8 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH |
| Gene Name | IL4R interleukin 4 receptor [ Homo sapiens ] |
| Official Symbol | IL4R |
| Synonyms | IL4R; interleukin 4 receptor; interleukin-4 receptor subunit alpha; CD124; IL-4 receptor subunit alpha; interleukin-4 receptor alpha chain; IL4RA; IL-4RA; |
| Gene ID | 3566 |
| mRNA Refseq | NM_000418 |
| Protein Refseq | NP_000409 |
| MIM | 147781 |
| UniProt ID | P24394 |
| ◆ Recombinant Proteins | ||
| IL4R-2037H | Recombinant Human IL4R protein, His-tagged | +Inquiry |
| Il4r-2198R | Active Recombinant Rat Il4r protein, His-tagged | +Inquiry |
| IL4R-4443H | Recombinant Human IL4R Protein, His (Fc)-Avi-tagged | +Inquiry |
| Il4r-379R | Active Recombinant Rat Il4r protein, hFc-tagged | +Inquiry |
| IL4R-331H | Recombinant Human IL4R Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL4R-2719HCL | Recombinant Human IL4R cell lysate | +Inquiry |
| IL4R-1051RCL | Recombinant Rat IL4R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL4R Products
Required fields are marked with *
My Review for All IL4R Products
Required fields are marked with *
