Recombinant Human IL6R Protein, C13 and N15 Labeled
Cat.No. : | IL6R-517H |
Product Overview : | C13 and N15 Labeled Recombinant human IL6R protein |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Protein Length : | 468 |
Description : | This gene encodes a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been identified in this gene. A pseudogene of this gene is found on chromosome 9. |
Form : | Lyophilized |
AA Sequence : | MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | IL6R interleukin 6 receptor [ Homo sapiens (human) ] |
Official Symbol | IL6R |
Synonyms | IL6R; interleukin 6 receptor; interleukin-6 receptor subunit alpha; CD126; IL-6R 1; CD126 antigen; membrane glycoprotein 80; IL-6 receptor subunit alpha; gp80; IL6RA; IL-6RA; IL-6R-1; MGC104991; |
Gene ID | 3570 |
mRNA Refseq | NM_000565 |
Protein Refseq | NP_000556 |
MIM | 147880 |
UniProt ID | P08887 |
◆ Recombinant Proteins | ||
IL6R-428H | Active Recombinant Human IL6R, His-tagged | +Inquiry |
IL6R-1064C | Active Recombinant Canine IL6R protein, His-tagged | +Inquiry |
IL6R-545H | Recombinant Human Interleukin 6 Receptor | +Inquiry |
IL6R-1241H | Recombinant Human Interleukin 6 Receptor, His-tagged | +Inquiry |
IL6R-056R | Recombinant Rat IL6R protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL6R-2903HCL | Recombinant Human IL6R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL6R Products
Required fields are marked with *
My Review for All IL6R Products
Required fields are marked with *
0
Inquiry Basket