Recombinant Human IL9 protein

Cat.No. : IL9-67H
Product Overview : Recombinant Human IL9 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 126
Description : Interleukin-9 (IL-9) is encoded by the IL9 gene and produced by T-cells and specifically by CD4+ helper cells. IL-9 was originally identified as a cytokine found in the conditioned medium of a human T cell leukemia virus type I (HTLVI) transformed T cell line. It functions through the IL-9 receptor, which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. IL-9 can support the growth of IL-2 independent and IL-4 independent helper T-cells. Human IL-9 has approximately 56 % amino acid sequence identity with murine IL-9. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyper-responsiveness.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human MO7e cells is less than 0.2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁶ IU/mg.
Molecular Mass : Approximately 14.1 kDa, a single non-glycosylated polypeptide chain containing 126 amino acids.
AA Sequence : QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Endotoxin : Less than 1 EU/µg of rHuIL-9 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name IL9
Official Symbol IL9
Synonyms IL9; interleukin 9; interleukin-9; homolog of mouse T cell and mast cell growth factor 40; HP40; IL 9; P40; p40 cytokine; p40 T cell and mast cell growth factor; T cell growth factor p40; cytokine P40; T-cell growth factor p40; p40 T-cell and mast cell growth factor; IL-9;
Gene ID 3578
mRNA Refseq NM_000590
Protein Refseq NP_000581
MIM 146931
UniProt ID P15248

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL9 Products

Required fields are marked with *

My Review for All IL9 Products

Required fields are marked with *

0
cart-icon