Species : |
Human |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
126 |
Description : |
Interleukin-9 (IL-9) is encoded by the IL9 gene and produced by T-cells and specifically by CD4+ helper cells. IL-9 was originally identified as a cytokine found in the conditioned medium of a human T cell leukemia virus type I (HTLVI) transformed T cell line. It functions through the IL-9 receptor, which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. IL-9 can support the growth of IL-2 independent and IL-4 independent helper T-cells. Human IL-9 has approximately 56 % amino acid sequence identity with murine IL-9. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyper-responsiveness. |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human MO7e cells is less than 0.2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁶ IU/mg. |
Molecular Mass : |
Approximately 14.1 kDa, a single non-glycosylated polypeptide chain containing 126 amino acids. |
AA Sequence : |
QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI |
Endotoxin : |
Less than 1 EU/µg of rHuIL-9 as determined by LAL method. |
Purity : |
>95% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |