Recombinant Human ILK Protein (1-228 aa), His-tagged
Cat.No. : | ILK-1179H |
Product Overview : | Recombinant Human ILK Protein (1-228 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-228 aa |
Description : | Receptor-proximal protein kinase regulating integrin-mediated signal transduction. May act as a mediator of inside-out integrin signaling. Focal adhesion protein part of the complex ILK-PINCH. This complex is considered to be one of the convergence points of integrin- and growth factor-signaling pathway. Could be implicated in mediating cell architecture, adhesion to integrin substrates and anchorage-dependent growth in epithelial cells. Phosphorylates beta-1 and beta-3 integrin subunit on serine and threonine residues, but also AKT1 and GSK3B. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 30.0 kDa |
AA Sequence : | MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | ILK integrin-linked kinase [ Homo sapiens ] |
Official Symbol | ILK |
Synonyms | ILK; ILK-1; p59ILK; P59; ILK-2; DKFZp686F1765; |
Gene ID | 3611 |
mRNA Refseq | NM_001014794 |
Protein Refseq | NP_001014794 |
MIM | 602366 |
UniProt ID | Q13418 |
◆ Recombinant Proteins | ||
ILK-12H | Recombinant Human ILK, MYC/DDK-tagged | +Inquiry |
ILK-5158H | Recombinant Human ILK Protein, GST-tagged | +Inquiry |
ILK-5768C | Recombinant Chicken ILK | +Inquiry |
ILK-7343H | Recombinant Human ILK protein, His-tagged | +Inquiry |
Ilk-3525M | Recombinant Mouse Ilk Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ILK-5219HCL | Recombinant Human ILK 293 Cell Lysate | +Inquiry |
ILK-5220HCL | Recombinant Human ILK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ILK Products
Required fields are marked with *
My Review for All ILK Products
Required fields are marked with *
0
Inquiry Basket