Recombinant Human ILK protein, His-tagged
Cat.No. : | ILK-643H |
Product Overview : | Recombinant Human ILK protein(Q13418)(1-452aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-452aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 58.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK |
Gene Name | ILK integrin-linked kinase [ Homo sapiens ] |
Official Symbol | ILK |
Synonyms | ILK; integrin-linked kinase; integrin-linked protein kinase; ILK-1; p59ILK; integrin-linked kinase-2; 59 kDa serine/threonine-protein kinase; P59; ILK-2; DKFZp686F1765; |
Gene ID | 3611 |
mRNA Refseq | NM_001014794 |
Protein Refseq | NP_001014794 |
MIM | 602366 |
UniProt ID | Q13418 |
◆ Recombinant Proteins | ||
ILK-2635H | Recombinant Human ILK Protein (Asn183-Lys452), N-His tagged | +Inquiry |
ILK-3586H | Recombinant Human ILK protein, His-tagged | +Inquiry |
ILK-2080R | Recombinant Rhesus Macaque ILK Protein, His (Fc)-Avi-tagged | +Inquiry |
ILK-643H | Recombinant Human ILK protein, His-tagged | +Inquiry |
ILK-3052R | Recombinant Rat ILK Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ILK-5220HCL | Recombinant Human ILK 293 Cell Lysate | +Inquiry |
ILK-5219HCL | Recombinant Human ILK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ILK Products
Required fields are marked with *
My Review for All ILK Products
Required fields are marked with *
0
Inquiry Basket