Recombinant Human IRAK2 protein, His-tagged
Cat.No. : | IRAK2-2753H |
Product Overview : | Recombinant Human IRAK2 protein(14-251 aa), fused to His tag, was expressed in E. coli. |
Availability | July 26, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 14-251 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | DDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITRELLWWWGMRQATVQQLVDLLCRLELYRAAQIILNWKPAPEIRCPIPAFPDSVKPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKLRETACSSPGSIE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | IRAK2 interleukin-1 receptor-associated kinase 2 [ Homo sapiens ] |
Official Symbol | IRAK2 |
Synonyms | IRAK2; interleukin-1 receptor-associated kinase 2; interleukin-1 receptor-associated kinase-like 2; interleukin-1 receptor associated kinase-2; IRAK-2; MGC150550; |
Gene ID | 3656 |
mRNA Refseq | NM_001570 |
Protein Refseq | NP_001561 |
MIM | 603304 |
UniProt ID | O43187 |
◆ Recombinant Proteins | ||
IRAK2-3094R | Recombinant Rat IRAK2 Protein | +Inquiry |
IRAK2-4596M | Recombinant Mouse IRAK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Irak2-7071R | Recombinant Rat Irak2 protein, His-tagged | +Inquiry |
IRAK2-2753H | Recombinant Human IRAK2 protein, His-tagged | +Inquiry |
IRAK2-2750R | Recombinant Rat IRAK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRAK2-5171HCL | Recombinant Human IRAK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRAK2 Products
Required fields are marked with *
My Review for All IRAK2 Products
Required fields are marked with *