Recombinant Human IRF9 Protein, His tagged

Cat.No. : IRF9-001H
Product Overview : Recombinant Human IRF9 protein (238-393 aa) with His tag was expressed in E. coli.
Availability June 13, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 238-393 aa
Description : This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Mutations in this gene result in Immunodeficiency 65.
Molecular Mass : 19 kDa
AA Sequence : MSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLVHHHHHHHH
Endotoxin : < 1 EU/μg by LAL.
Purity : > 90 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 10 % Glycerol
Concentration : 0.72 mg/mL by BCA
Gene Name IRF9 interferon regulatory factor 9 [ Homo sapiens (human) ]
Official Symbol IRF9
Synonyms IRF9; interferon regulatory factor 9; interferon stimulated transcription factor 3, gamma (48kD), interferon stimulated transcription factor 3, gamma 48kDa, ISGF3G; ISGF-3 gamma; ISGF3 p48 subunit; interferon-stimulated gene factor 3 gamma; transcriptional regulator ISGF3 subunit gamma; IFN-alpha-responsive transcription factor subunit; interferon-stimulated transcription factor 3, gamma 48kDa; interferon-stimulated transcription factor 3, gamma (48kD); p48; IRF-9; ISGF3; ISGF3G
Gene ID 10379
mRNA Refseq NM_006084
Protein Refseq NP_006075
MIM 147574
UniProt ID Q00978

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IRF9 Products

Required fields are marked with *

My Review for All IRF9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon