Recombinant Human IRF9 Protein, His tagged
Cat.No. : | IRF9-001H |
Product Overview : | Recombinant Human IRF9 protein (238-393 aa) with His tag was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 238-393 aa |
Description : | This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Mutations in this gene result in Immunodeficiency 65. |
Molecular Mass : | 19 kDa |
AA Sequence : | MSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLVHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL. |
Purity : | > 90 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 10 % Glycerol |
Concentration : | 0.72 mg/mL by BCA |
Gene Name | IRF9 interferon regulatory factor 9 [ Homo sapiens (human) ] |
Official Symbol | IRF9 |
Synonyms | IRF9; interferon regulatory factor 9; interferon stimulated transcription factor 3, gamma (48kD), interferon stimulated transcription factor 3, gamma 48kDa, ISGF3G; ISGF-3 gamma; ISGF3 p48 subunit; interferon-stimulated gene factor 3 gamma; transcriptional regulator ISGF3 subunit gamma; IFN-alpha-responsive transcription factor subunit; interferon-stimulated transcription factor 3, gamma 48kDa; interferon-stimulated transcription factor 3, gamma (48kD); p48; IRF-9; ISGF3; ISGF3G |
Gene ID | 10379 |
mRNA Refseq | NM_006084 |
Protein Refseq | NP_006075 |
MIM | 147574 |
UniProt ID | Q00978 |
◆ Recombinant Proteins | ||
Irf9-3586M | Recombinant Mouse Irf9 Protein, Myc/DDK-tagged | +Inquiry |
IRF9-630C | Recombinant Cynomolgus IRF9 Protein, His-tagged | +Inquiry |
IRF9-1758HFL | Recombinant Full Length Human IRF9 Protein, C-Flag-tagged | +Inquiry |
IRF9-3631H | Recombinant Human IRF9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IRF9-2123R | Recombinant Rhesus Macaque IRF9 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRF9-5158HCL | Recombinant Human IRF9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRF9 Products
Required fields are marked with *
My Review for All IRF9 Products
Required fields are marked with *