Recombinant Human IRF9 Protein, His tagged

• Cat.No.: IRF9-001H
• Product Overview: Recombinant Human IRF9 protein (238-393 aa) with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 238-393 aa
• Description: This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Mutations in this gene result in Immunodeficiency 65.
• Molecular Mass: 19 kDa
• AA Sequence: MSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLVHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL.
• Purity: > 90 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 10 % Glycerol
• Concentration: 0.72 mg/mL by BCA

Gene Information

• Gene Name: IRF9 interferon regulatory factor 9 [ Homo sapiens (human) ]
• Official Symbol: IRF9
• Synonyms: IRF9; interferon regulatory factor 9; interferon stimulated transcription factor 3, gamma (48kD), interferon stimulated transcription factor 3, gamma 48kDa, ISGF3G; ISGF-3 gamma; ISGF3 p48 subunit; interferon-stimulated gene factor 3 gamma; transcriptional regulator ISGF3 subunit gamma; IFN-alpha-responsive transcription factor subunit; interferon-stimulated transcription factor 3, gamma 48kDa; interferon-stimulated transcription factor 3, gamma (48kD); p48; IRF-9; ISGF3; ISGF3G
• Gene ID: 10379
• mRNA Refseq: NM_006084
• Protein Refseq: NP_006075
• MIM: 147574
• UniProt ID: Q00978