Recombinant Human IRF9 Protein, His tagged
| Cat.No. : | IRF9-001H |
| Product Overview : | Recombinant Human IRF9 protein (238-393 aa) with His tag was expressed in E. coli. |
| Availability | December 04, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 238-393 aa |
| Description : | This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Mutations in this gene result in Immunodeficiency 65. |
| Molecular Mass : | 19 kDa |
| AA Sequence : | MSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLVHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL. |
| Purity : | > 90 % by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4, 10 % Glycerol |
| Concentration : | 0.72 mg/mL by BCA |
| Gene Name | IRF9 interferon regulatory factor 9 [ Homo sapiens (human) ] |
| Official Symbol | IRF9 |
| Synonyms | IRF9; interferon regulatory factor 9; interferon stimulated transcription factor 3, gamma (48kD), interferon stimulated transcription factor 3, gamma 48kDa, ISGF3G; ISGF-3 gamma; ISGF3 p48 subunit; interferon-stimulated gene factor 3 gamma; transcriptional regulator ISGF3 subunit gamma; IFN-alpha-responsive transcription factor subunit; interferon-stimulated transcription factor 3, gamma 48kDa; interferon-stimulated transcription factor 3, gamma (48kD); p48; IRF-9; ISGF3; ISGF3G |
| Gene ID | 10379 |
| mRNA Refseq | NM_006084 |
| Protein Refseq | NP_006075 |
| MIM | 147574 |
| UniProt ID | Q00978 |
| ◆ Recombinant Proteins | ||
| IRF9-5016H | Recombinant Human IRF9 Protein, GST-tagged | +Inquiry |
| IRF9-2302R | Recombinant Rhesus monkey IRF9 Protein, His-tagged | +Inquiry |
| IRF9-001H | Recombinant Human IRF9 Protein, His tagged | +Inquiry |
| Irf9-4635M | Recombinant Mouse Irf9 protein, His-tagged | +Inquiry |
| IRF9-1758HFL | Recombinant Full Length Human IRF9 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IRF9-5158HCL | Recombinant Human IRF9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRF9 Products
Required fields are marked with *
My Review for All IRF9 Products
Required fields are marked with *
