Recombinant Human IRS1 protein(831-900 aa), C-His-tagged

Cat.No. : IRS1-2738H
Product Overview : Recombinant Human IRS1 protein(P35568)(831-900 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 831-900 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : HPHHQVLQPHLPRKVDTAAQTNSRLARPTRLSLGDPKASTLPRAREQQQQQQPLLHPPEPKSPGEYVNIE
Gene Name IRS1 insulin receptor substrate 1 [ Homo sapiens ]
Official Symbol IRS1
Synonyms IRS1; insulin receptor substrate 1; HIRS 1; IRS-1; HIRS-1;
Gene ID 3667
mRNA Refseq NM_005544
Protein Refseq NP_005535
UniProt ID P35568

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IRS1 Products

Required fields are marked with *

My Review for All IRS1 Products

Required fields are marked with *

0
cart-icon
0
compare icon