Recombinant Human IRS1 protein(831-900 aa), C-His-tagged
| Cat.No. : | IRS1-2738H |
| Product Overview : | Recombinant Human IRS1 protein(P35568)(831-900 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 831-900 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | HPHHQVLQPHLPRKVDTAAQTNSRLARPTRLSLGDPKASTLPRAREQQQQQQPLLHPPEPKSPGEYVNIE |
| Gene Name | IRS1 insulin receptor substrate 1 [ Homo sapiens ] |
| Official Symbol | IRS1 |
| Synonyms | IRS1; insulin receptor substrate 1; HIRS 1; IRS-1; HIRS-1; |
| Gene ID | 3667 |
| mRNA Refseq | NM_005544 |
| Protein Refseq | NP_005535 |
| UniProt ID | P35568 |
| ◆ Recombinant Proteins | ||
| IRS1-12HCL | Recombinant Human IRS1 HEK293T cell lysate | +Inquiry |
| IRS1-3380H | Recombinant Human IRS1 Protein (Pro4-Arg267), N-His tagged | +Inquiry |
| IRS1-28726TH | Recombinant Human IRS1 | +Inquiry |
| IRS1-1466H | Recombinant Human Insulin Receptor Substrate 1, GST-tagged | +Inquiry |
| IRS1-2755R | Recombinant Rat IRS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IRS1-872HCL | Recombinant Human IRS1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRS1 Products
Required fields are marked with *
My Review for All IRS1 Products
Required fields are marked with *
