Recombinant Human IRS1 protein, MBP&His-Avi-tagged, Biotinylated
Cat.No. : | IRS1-4543H |
Product Overview : | Biotinylated Recombinant Human IRS1 protein(P35568)(157-267aa), fused with N-terminal MBP tag and C-terminal His and Avi tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Avi&His&MBP |
Protein Length : | 157-267aa |
Conjugation/Label : | Biotin |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 60.3 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GPAFKEVWQVILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDSVVAQNMHETILEAMRAMSDEFRPR |
Gene Name | IRS1 insulin receptor substrate 1 [ Homo sapiens ] |
Official Symbol | IRS1 |
Synonyms | IRS1; insulin receptor substrate 1; HIRS 1; IRS-1; HIRS-1; |
Gene ID | 3667 |
mRNA Refseq | NM_005544 |
Protein Refseq | NP_005535 |
UniProt ID | P35568 |
◆ Recombinant Proteins | ||
IRS1-1467H | Recombinant Human Insulin Receptor Substrate 1, GST-tagged | +Inquiry |
IRS1-3380H | Recombinant Human IRS1 Protein (Pro4-Arg267), N-His tagged | +Inquiry |
IRS1-1466H | Recombinant Human Insulin Receptor Substrate 1, GST-tagged | +Inquiry |
IRS1-28643TH | Recombinant Human IRS1 | +Inquiry |
IRS1-28726TH | Recombinant Human IRS1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRS1-872HCL | Recombinant Human IRS1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IRS1 Products
Required fields are marked with *
My Review for All IRS1 Products
Required fields are marked with *
0
Inquiry Basket