Recombinant Human IRS2 Protein, GST-tagged
Cat.No. : | IRS2-5029H |
Product Overview : | Human IRS2 partial ORF ( NP_003740.2, 494 a.a. - 603 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the insulin receptor substrate 2, a cytoplasmic signaling molecule that mediates effects of insulin, insulin-like growth factor 1, and other cytokines by acting as a molecular adaptor between diverse receptor tyrosine kinases and downstream effectors. The product of this gene is phosphorylated by the insulin receptor tyrosine kinase upon receptor stimulation, as well as by an interleukin 4 receptor-associated kinase in response to IL4 treatment. [provided by RefSeq |
Molecular Mass : | 37.84 kDa |
AA Sequence : | DPGFMSLDEYGSSPGDLRAFCSHRSNTPESIAETPPARDGGGGGEFYGYMTMDRPLSHCGRSYRRVSGDAAQDLDRGLRKRTYSLTTPARQRPVPQPSSASLDEYTLMRA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IRS2 insulin receptor substrate 2 [ Homo sapiens ] |
Official Symbol | IRS2 |
Synonyms | IRS2; insulin receptor substrate 2; IRS-2; |
Gene ID | 8660 |
mRNA Refseq | NM_003749 |
Protein Refseq | NP_003740 |
MIM | 600797 |
UniProt ID | Q9Y4H2 |
◆ Recombinant Proteins | ||
IRS2-4611M | Recombinant Mouse IRS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
IRS2-5029H | Recombinant Human IRS2 Protein, GST-tagged | +Inquiry |
IRS2-3213H | Recombinant Human IRS2 Protein (Ser985-Ala1255), N-His tagged | +Inquiry |
IRS2-1051H | Recombinant Human IRS2 protein, His & T7-tagged | +Inquiry |
IRS2-8314M | Recombinant Mouse IRS2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRS2 Products
Required fields are marked with *
My Review for All IRS2 Products
Required fields are marked with *