Recombinant Human IRS2 Protein, GST-tagged

Cat.No. : IRS2-5029H
Product Overview : Human IRS2 partial ORF ( NP_003740.2, 494 a.a. - 603 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes the insulin receptor substrate 2, a cytoplasmic signaling molecule that mediates effects of insulin, insulin-like growth factor 1, and other cytokines by acting as a molecular adaptor between diverse receptor tyrosine kinases and downstream effectors. The product of this gene is phosphorylated by the insulin receptor tyrosine kinase upon receptor stimulation, as well as by an interleukin 4 receptor-associated kinase in response to IL4 treatment. [provided by RefSeq
Molecular Mass : 37.84 kDa
AA Sequence : DPGFMSLDEYGSSPGDLRAFCSHRSNTPESIAETPPARDGGGGGEFYGYMTMDRPLSHCGRSYRRVSGDAAQDLDRGLRKRTYSLTTPARQRPVPQPSSASLDEYTLMRA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IRS2 insulin receptor substrate 2 [ Homo sapiens ]
Official Symbol IRS2
Synonyms IRS2; insulin receptor substrate 2; IRS-2;
Gene ID 8660
mRNA Refseq NM_003749
Protein Refseq NP_003740
MIM 600797
UniProt ID Q9Y4H2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IRS2 Products

Required fields are marked with *

My Review for All IRS2 Products

Required fields are marked with *

0
cart-icon