Recombinant Human ITGA2B protein(751-820 aa), C-hFc & C-His-tagged
Cat.No. : | ITGA2B-2598H |
Product Overview : | Recombinant Human ITGA2B protein(P08514)(751-820 aa), fused with C-terminal hFc and C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc&His |
Protein Length : | 751-820 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | QLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNN |
Gene Name | ITGA2B integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) [ Homo sapiens ] |
Official Symbol | ITGA2B |
Synonyms | ITGA2B; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); GP2B, integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41B); integrin alpha-IIb; CD41; CD41B; GPalpha IIb; platelet-specific antigen BAK; platelet membrane glycoprotein IIb; platelet fibrinogen receptor, alpha subunit; GT; GTA; GP2B; HPA3; GPIIb; BDPLT2; |
Gene ID | 3674 |
mRNA Refseq | NM_000419 |
Protein Refseq | NP_000410 |
MIM | 607759 |
UniProt ID | P08514 |
◆ Recombinant Proteins | ||
ITGA2B-5676M | Recombinant Rhesus macaque ITGA2B Protein (Met52-Leu959), C-His tagged | +Inquiry |
ITGA2B-2598H | Recombinant Human ITGA2B protein(751-820 aa), C-hFc & C-His-tagged | +Inquiry |
ITGA2B-4635M | Recombinant Mouse ITGA2B Protein, His (Fc)-Avi-tagged | +Inquiry |
ITGA2B-1144Z | Recombinant Zebrafish ITGA2B | +Inquiry |
Itga2b-3593M | Recombinant Mouse Itga2b Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
ITGA2B-10H | Native Human GPIIbIIIa | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGA2B Products
Required fields are marked with *
My Review for All ITGA2B Products
Required fields are marked with *