Recombinant Human ITGA2B protein, His-SUMO-tagged
| Cat.No. : | ITGA2B-3124H |
| Product Overview : | Recombinant Human ITGA2B protein(P08514)(639-887aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 639-887aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 43 kDa |
| AA Sequence : | CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | ITGA2B integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) [ Homo sapiens ] |
| Official Symbol | ITGA2B |
| Synonyms | ITGA2B; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); GP2B, integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41B); integrin alpha-IIb; CD41; CD41B; GPalpha IIb; platelet-specific antigen BAK; platelet membrane glycoprotein IIb; platelet fibrinogen receptor, alpha subunit; GT; GTA; GP2B; HPA3; GPIIb; BDPLT2; |
| Gene ID | 3674 |
| mRNA Refseq | NM_000419 |
| Protein Refseq | NP_000410 |
| MIM | 607759 |
| UniProt ID | P08514 |
| ◆ Recombinant Proteins | ||
| ITGA2B-1208H | Recombinant Human ITGA2B Protein, His (Fc)-Avi-tagged | +Inquiry |
| ITGA2B-2615H | Recombinant Human ITGA2B Protein, MYC/DDK-tagged | +Inquiry |
| ITGA2B-1425H | Recombinant Human ITGA2B Protein (639-887 aa), His-tagged | +Inquiry |
| ITGA2B-2598H | Recombinant Human ITGA2B protein(751-820 aa), C-hFc & C-His-tagged | +Inquiry |
| ITGA2B-5758H | Recombinant Human ITGA2B protein, His & T7-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ITGA2B-10H | Native Human GPIIbIIIa | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGA2B Products
Required fields are marked with *
My Review for All ITGA2B Products
Required fields are marked with *




