Recombinant Human ITGA2B protein, His-SUMO-tagged

Cat.No. : ITGA2B-3124H
Product Overview : Recombinant Human ITGA2B protein(P08514)(639-887aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 639-887aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 43 kDa
AA Sequence : CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKR
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name ITGA2B integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) [ Homo sapiens ]
Official Symbol ITGA2B
Synonyms ITGA2B; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); GP2B, integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41B); integrin alpha-IIb; CD41; CD41B; GPalpha IIb; platelet-specific antigen BAK; platelet membrane glycoprotein IIb; platelet fibrinogen receptor, alpha subunit; GT; GTA; GP2B; HPA3; GPIIb; BDPLT2;
Gene ID 3674
mRNA Refseq NM_000419
Protein Refseq NP_000410
MIM 607759
UniProt ID P08514

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITGA2B Products

Required fields are marked with *

My Review for All ITGA2B Products

Required fields are marked with *

0
cart-icon