Recombinant Human ITGA2B protein, His-SUMO-tagged
Cat.No. : | ITGA2B-3124H |
Product Overview : | Recombinant Human ITGA2B protein(P08514)(639-887aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 639-887aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43 kDa |
AA Sequence : | CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ITGA2B integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) [ Homo sapiens ] |
Official Symbol | ITGA2B |
Synonyms | ITGA2B; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); GP2B, integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41B); integrin alpha-IIb; CD41; CD41B; GPalpha IIb; platelet-specific antigen BAK; platelet membrane glycoprotein IIb; platelet fibrinogen receptor, alpha subunit; GT; GTA; GP2B; HPA3; GPIIb; BDPLT2; |
Gene ID | 3674 |
mRNA Refseq | NM_000419 |
Protein Refseq | NP_000410 |
MIM | 607759 |
UniProt ID | P08514 |
◆ Recombinant Proteins | ||
ITGA2B-4999H | Recombinant Human ITGA2B Protein, GST-tagged | +Inquiry |
ITGA2B-4318H | Recombinant Human ITGA2B Protein (Met1-Arg993), C-His tagged | +Inquiry |
ITGA2B-1144Z | Recombinant Zebrafish ITGA2B | +Inquiry |
ITGA2B-1586H | Recombinant Human ITGA2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ITGA2B-1208H | Recombinant Human ITGA2B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
ITGA2B-10H | Native Human GPIIbIIIa | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGA2B Products
Required fields are marked with *
My Review for All ITGA2B Products
Required fields are marked with *