Recombinant Human ITGA4 protein(376-558aa), His-GST-tagged

• Cat.No.: ITGA4-2321H
• Product Overview: Recombinant Human ITGA4 protein(P13612)(376-558aa), fused with N-terminal His and GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His
• Protein Length: 376-558aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 51.5 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: GDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRADGISSTFSQRIEGLQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVDASLSHPESVNRTKFDCVENGWPSVCIDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPPRFYFSSNGTSDVITGSIQVSSREANCR

Gene Information

• Gene Name: ITGA4 integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor) [ Homo sapiens ]
• Official Symbol: ITGA4
• Synonyms: ITGA4; integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor); CD49D; integrin alpha-4; CD49d; 269C wild type; integrin alpha 4; integrin alpha-IV; VLA-4 subunit alpha; integrin alpha-4 subunit; CD49 antigen-like family member D; antigen CD49D, alpha-4 subunit of VLA-4 receptor; very late activation protein 4 receptor, alpha 4 subunit; IA4; MGC90518
• Gene ID: 3676
• mRNA Refseq: NM_000885
• Protein Refseq: NP_000876
• MIM: 192975
• UniProt ID: P13612