Recombinant Human ITGA4 protein(376-558aa), His-GST-tagged

Cat.No. : ITGA4-2321H
Product Overview : Recombinant Human ITGA4 protein(P13612)(376-558aa), fused with N-terminal His and GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 376-558aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 51.5 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : GDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRADGISSTFSQRIEGLQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVDASLSHPESVNRTKFDCVENGWPSVCIDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPPRFYFSSNGTSDVITGSIQVSSREANCR
Gene Name ITGA4 integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor) [ Homo sapiens ]
Official Symbol ITGA4
Synonyms ITGA4; integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor); CD49D; integrin alpha-4; CD49d; 269C wild type; integrin alpha 4; integrin alpha-IV; VLA-4 subunit alpha; integrin alpha-4 subunit; CD49 antigen-like family member D; antigen CD49D, alpha-4 subunit of VLA-4 receptor; very late activation protein 4 receptor, alpha 4 subunit; IA4; MGC90518;
Gene ID 3676
mRNA Refseq NM_000885
Protein Refseq NP_000876
MIM 192975
UniProt ID P13612

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITGA4 Products

Required fields are marked with *

My Review for All ITGA4 Products

Required fields are marked with *

0
cart-icon