Recombinant Human ITGAM protein, His-GST-tagged

Cat.No. : ITGAM-432H
Product Overview : Recombinant Human ITGAM protein(P11215)(46-150aa), fused with N-terminal His and GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 46-150aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 57.1 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : VLFQGPLGSPEFRTVVVGAPQEIVAANQRGSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVKGLCFLFGSNLRQQPQKFPEALRGCPQEDSDGRTRAPPPPPLRSGCQSPKGSVGCCHRAITSITPWGLTGLEGFFAERRNYIRIGEWDAPCSGALSAAGVVVTRSVTATLASALAPAPFAFFPSFLATFAGFPRQALNRGLPLGFRFSALRHL
Gene Name ITGAM integrin, alpha M (complement component 3 receptor 3 subunit) [ Homo sapiens ]
Official Symbol ITGAM
Synonyms ITGAM; integrin, alpha M (complement component 3 receptor 3 subunit); CD11B, CR3A, integrin, alpha M (complement component receptor 3, alpha; also known as CD11b (p170), macrophage antigen alpha polypeptide); integrin alpha-M; CD11b; MAC 1; CR-3 alpha chain; antigen CD11b (p170); leukocyte adhesion receptor MO1; CD11 antigen-like family member B; macrophage antigen alpha polypeptide; cell surface glycoprotein MAC-1 subunit alpha; neutrophil adherence receptor alpha-M subunit; CR3A; MO1A; CD11B; MAC-1; MAC1A; SLEB6; MGC117044;
Gene ID 3684
mRNA Refseq NM_000632
Protein Refseq NP_000623
MIM 120980
UniProt ID P11215

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITGAM Products

Required fields are marked with *

My Review for All ITGAM Products

Required fields are marked with *

0
cart-icon
0
compare icon