Recombinant Human ITGB3 protein, His-tagged
Cat.No. : | ITGB3-2940H |
Product Overview : | Recombinant Human ITGB3 protein(634-718 aa), fused to His tag, was expressed in E. coli. |
Availability | June 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 634-718 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | CTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPD |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ITGB3 integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61) [ Homo sapiens ] |
Official Symbol | ITGB3 |
Synonyms | ITGB3; integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61); GP3A; integrin beta-3; CD61; GPIIIa; platelet glycoprotein IIIa; platelet membrane glycoprotein IIIa; GT; BDPLT2; |
Gene ID | 3690 |
mRNA Refseq | NM_000212 |
Protein Refseq | NP_000203 |
UniProt ID | P05106 |
◆ Recombinant Proteins | ||
ITGB3-16H | Recombinant Human ITGB3 Protein, His-tagged | +Inquiry |
ITGB3-2940H | Recombinant Human ITGB3 protein, His-tagged | +Inquiry |
Itgb3-6741M | Recombinant Mouse Itgb3 protein, His & S-tagged | +Inquiry |
ITGb3-3269H | Recombinant Human ITGb3 protein, His-tagged | +Inquiry |
ITGB3-5888C | Recombinant Chicken ITGB3 | +Inquiry |
◆ Native Proteins | ||
ITGB3-11H | Native Human GPIIbIIIa | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGB3-5124HCL | Recombinant Human ITGB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGB3 Products
Required fields are marked with *
My Review for All ITGB3 Products
Required fields are marked with *