Recombinant Human ITGB3 protein, His-tagged
| Cat.No. : | ITGB3-2940H |
| Product Overview : | Recombinant Human ITGB3 protein(634-718 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 26, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 634-718 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | CTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPD |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ITGB3 integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61) [ Homo sapiens ] |
| Official Symbol | ITGB3 |
| Synonyms | ITGB3; integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61); GP3A; integrin beta-3; CD61; GPIIIa; platelet glycoprotein IIIa; platelet membrane glycoprotein IIIa; GT; BDPLT2; |
| Gene ID | 3690 |
| mRNA Refseq | NM_000212 |
| Protein Refseq | NP_000203 |
| UniProt ID | P05106 |
| ◆ Recombinant Proteins | ||
| ITGB3-2940H | Recombinant Human ITGB3 protein, His-tagged | +Inquiry |
| ITGB3-5888C | Recombinant Chicken ITGB3 | +Inquiry |
| ITGB3-2555H | Recombinant Human ITGB3 protein(631-700 aa), C-His-tagged | +Inquiry |
| ITGB3-4327H | Recombinant Human ITGB3 Protein (Met1-Asp718), C-His tagged | +Inquiry |
| Itgb3-6741M | Recombinant Mouse Itgb3 protein, His & S-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ITGB3-11H | Native Human GPIIbIIIa | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ITGB3-5124HCL | Recombinant Human ITGB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGB3 Products
Required fields are marked with *
My Review for All ITGB3 Products
Required fields are marked with *
