Recombinant Human ITPR1 Protein, GST-tagged
| Cat.No. : | ITPR1-4945H |
| Product Overview : | Human ITPR1 partial ORF ( NP_002213, 2470 a.a. - 2577 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes an intracellular receptor for inositol 1,4,5-trisphosphate. Upon stimulation by inositol 1,4,5-trisphosphate, this receptor mediates calcium release from the endoplasmic reticulum. Mutations in this gene cause spinocerebellar ataxia type 15, a disease associated with an heterogeneous group of cerebellar disorders. Multiple transcript variants have been identified for this gene. [provided by RefSeq, Nov 2009] |
| Molecular Mass : | 37.62 kDa |
| AA Sequence : | EHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ITPR1 inositol 1,4,5-trisphosphate receptor, type 1 [ Homo sapiens ] |
| Official Symbol | ITPR1 |
| Synonyms | ITPR1; inositol 1,4,5-trisphosphate receptor, type 1; SCA15, SCA16, spinocerebellar ataxia 15 , spinocerebellar ataxia 16; inositol 1,4,5-trisphosphate receptor type 1; Insp3r1; IP3R1; IP3R 1; IP3 receptor; type 1 InsP3 receptor; inositol 1,4,5-triphosphate receptor, type 1; type 1 inositol 1,4,5-trisphosphate receptor; IP3R; SCA15; SCA16; INSP3R1; DKFZp313E1334; DKFZp313N1434; |
| Gene ID | 3708 |
| mRNA Refseq | NM_001099952 |
| Protein Refseq | NP_001093422 |
| MIM | 147265 |
| UniProt ID | Q14643 |
| ◆ Recombinant Proteins | ||
| ITPR1-2346H | Recombinant Human ITPR1 Protein, His-tagged | +Inquiry |
| ITPR1-4075C | Recombinant Chicken ITPR1 | +Inquiry |
| ITPR1-4655M | Recombinant Mouse ITPR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ITPR1-8389M | Recombinant Mouse ITPR1 Protein | +Inquiry |
| ITPR1-4945H | Recombinant Human ITPR1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITPR1 Products
Required fields are marked with *
My Review for All ITPR1 Products
Required fields are marked with *
