Recombinant Human ITPR1 Protein, GST-tagged

Cat.No. : ITPR1-4945H
Product Overview : Human ITPR1 partial ORF ( NP_002213, 2470 a.a. - 2577 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes an intracellular receptor for inositol 1,4,5-trisphosphate. Upon stimulation by inositol 1,4,5-trisphosphate, this receptor mediates calcium release from the endoplasmic reticulum. Mutations in this gene cause spinocerebellar ataxia type 15, a disease associated with an heterogeneous group of cerebellar disorders. Multiple transcript variants have been identified for this gene. [provided by RefSeq, Nov 2009]
Molecular Mass : 37.62 kDa
AA Sequence : EHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ITPR1 inositol 1,4,5-trisphosphate receptor, type 1 [ Homo sapiens ]
Official Symbol ITPR1
Synonyms ITPR1; inositol 1,4,5-trisphosphate receptor, type 1; SCA15, SCA16, spinocerebellar ataxia 15 , spinocerebellar ataxia 16; inositol 1,4,5-trisphosphate receptor type 1; Insp3r1; IP3R1; IP3R 1; IP3 receptor; type 1 InsP3 receptor; inositol 1,4,5-triphosphate receptor, type 1; type 1 inositol 1,4,5-trisphosphate receptor; IP3R; SCA15; SCA16; INSP3R1; DKFZp313E1334; DKFZp313N1434;
Gene ID 3708
mRNA Refseq NM_001099952
Protein Refseq NP_001093422
MIM 147265
UniProt ID Q14643

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITPR1 Products

Required fields are marked with *

My Review for All ITPR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon